Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Human FAS (aa 26-96) Control Fragment Recombinant Protein
Product Details
RP-95096
Applications
Tested Dilution
Publications
Product Specifications
Species
Human
Expression System
E. coli
Amino acid sequence
QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAH
Tag
His-ABP-tag
Class
Recombinant
Type
Protein
Purity
>80% by SDS-PAGE and Coomassie blue staining
Conjugate
Form
Liquid
Concentration
≥5.0 mg/mL
Purification
purified
Storage buffer
1M urea/PBS, pH 7.4
Contains
no preservative
Storage conditions
-20°C, Avoid Freeze/Thaw Cycles
Product Specific Information
Highest antigen sequence indentity to the following orthologs: Mouse (48%), Rat (48%).
This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110937. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.
Target Information
FAS (Fas, CD95, APO-1) is a 46 kDa transmembrane glycoprotein that functions as a cell death receptor of the TNFR (tumor necrosis factor receptor) superfamily. FAS also exists in a soluble form that weight approximately 26kDa. Stimulation of FAS results in aggregation of its intracellular FAS-associated death domains (FADD), formation of the death-inducing signaling complex (DISC) and activation of caspases. The auto-proteolytic processing of the caspases in the complex trigger a downstream cascade that leads to apoptosis. FAS has been shown to activate NF-kappaB, MAPK3/ERK1, MAPK8/JNK, and is involved in transducing the proliferating signals in normal diploid fibroblast and T cells. At least eight alternatively spliced transcript variants encoding seven distinct isoforms have been described. The isoforms lacking the transmembrane domain may negatively regulate the apoptosis mediated by the full-length isoform. The Fas/Fas ligand system has been shown to play a role in a number of human diseases such as AIDS, hepatitis and cancer. It is also assumed that induction of apoptosis through FAS ligand pathway is predominantly involved in anti-viral immune responses.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Apo-1 antigen; APO-1 cell surface antigen; Apo-1 Fas; Apo1 antigen; apoptosis antigen 1; apoptosis signaling receptor FAS; Apoptosis-mediating surface antigen FAS; CD95; CD95 antigen; Fas (TNF receptor superfamily, member 6); Fas AMA; FASLG receptor; OTTHUMP00000020045; OTTHUMP00000020046; OTTHUMP00000020051; OTTHUMP00000059646; TNF receptor superfamily member 6; Tumor necrosis factor receptor superfamily member 6; tumor necrosis factor receptor superfamily, member 6
Gene Aliases: ALPS1A; APO-1; APT1; CD95; FAS; FAS1; FASTM; TNFRSF6
UniProt ID: (Human) Q14293
Entrez Gene ID: (Human) 355
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support