Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
14-3-3 zeta Monoclonal Antibody (6H7)
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 1
14-3-3 zeta Antibody (MA5-49185) in WB
Western blot analysis of 14-3-3 zeta/delta using 14-3-3 zeta/delta antibody (Product # MA5-49185). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50 µg of sample under reducing conditions. Lane 1: human Hela whole cell lysates; Lane 2: human A549 whole cell lysates; Lane 3: monkey COS-7 whole cell lysates; Lane 4: human Raji whole cell lysates; Lane 5: human Caco-2 whole cell lysates; Lane 6: human Jurkat whole cell lysates; Lane ... View More
Product Details
MA5-49185
Product Specifications
Species Reactivity
Human,
Mouse,
Non-human primate,
Rat
Host/Isotype
Mouse
/ IgG1
Class
Monoclonal
Type
Antibody
Clone
6H7
Immunogen
A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta (LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_3074843
Product Specific Information
Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Positive Control - WB: human Hela whole cell, human A549 whole cell, monkey COS-7 whole cell, human Raji whole cell, huamn Caco-2 whole cell, huamn Jurkat whole cell, mouse brain tissue, rat brain tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
At least seven isoforms comprise the highly conserved 14-3-3 family of homo- and heterodimeric proteins that are abundantly expressed in all eukaryotic cells. Although more than seven isoforms of 14-3-3 have been described, some redundancies have appeared upon sequencing. The 14-3-3s are thought to be key regulators of signal transduction events mediated through their binding to serine-phosphorylated proteins. By interacting with Cdc25C, 14-3-3 regulates entry into the cell cycle and through interaction with Bad, prevents apoptosis. Other proteins that have been shown to bind to 14-3-3s include members of the protein kinase C family, Cbl, IRS-1, polyoma middle-T antigen, nitrate reductase, S-raf and the IGF-1 receptor. Detection of 14-3-3 proteins in cerebrospinal fluid has been shown to be useful in the differential diagnosis of Creutzfeldt-Jakob disease and other prion diseases.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 14-3-3 delta; 14-3-3 protein zeta/delta; 14-3-3 protein/cytosolic phospholipase A2; 14-3-3 zeta; 1433Z; 143Z; epididymis luminal protein 4; epididymis secretory protein Li 3; epididymis secretory protein Li 93; KCIP-1; Mitochondrial import stimulation factor S1 subunit; phospholipase A2; Protein kinase C inhibitor protein 1; protein kinase C inhibitor protein-1; SEZ-2; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, delta polypeptide; tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide; tyrosine 3/tryptophan 5 -monooxygenase activation protein, zeta polypeptide
Gene Aliases: 1110013I11Rik; 14-3-3-zeta; 14-3-3z; 14-3-3zeta; AI596267; AL022924; AU020854; HEL-S-3; HEL-S-93; HEL4; KCIP-1; Msfs1; YWHAD; YWHAZ
UniProt ID: (Human) P63104, (Mouse) P63101, (Rat) P63102
Entrez Gene ID: (Human) 7534, (Mouse) 22631, (Rat) 25578
protein targeting
signal transduction
platelet activation
negative regulation of apoptotic process
regulation of mRNA stability
establishment of Golgi localization
membrane organization
Golgi reassembly
cell-cell adhesion
positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway
histamine secretion by mast cell
protein targeting to mitochondrion
regulation of cell death
response to drug
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support