Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • ACTH Antibodies

          Fabgennix

          ACTH Polyclonal Antibody, FITC

          View all (48) ACTH antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite ACTH Polyclonal Antibody, FITC

          • Antibody Testing Data (1)
          ACTH Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          ACTH Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          ACTH Antibody (ACTH-FITC) in WB

          Slot blot of ACTH with ACTH-101AP. Varying concentration of ACTH was blotted on Nitrocellulose and probed at 1:500 antibody dilution in DiluObuffer. {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          ACTH Antibody in Western Blot (WB)

          Product Details

          ACTH-FITC

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          1:500-1:1,000
          -

          Immunohistochemistry (IHC)

          1:50-1:250
          -

          Immunocytochemistry (ICC/IF)

          1:50-1:250
          -

          ELISA (ELISA)

          1:10,000
          -

          Immunoprecipitation (IP)

          1:100-1:250
          -

          Dot blot (DB)

          1:10,000
          -

          Immunomicroscopy (IM)

          1:50-1:200
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Non-human primate, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          Synthetic peptide corresponding to ACTH aa 138-176. Sequence:SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
          View immunogen

          Conjugate

          FITC FITC FITC

          Excitation/Emission Max

          498/517 nm View spectra spectra

          Form

          Liquid

          Concentration

          0.5-1.5 mg/mL

          Purification

          Affinity chromatography

          Storage buffer

          proprietary buffer, pH 7.4-7.8, with 30% glycerol, 0.5% BSA

          Contains

          0.02% sodium azide

          Storage conditions

          -20°C, store in dark

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          Target Information

          ATCH (adrenocorticotropic hormone) is a hormone which plays a major role in stimulating the adrenal cortex. It is formed through cleavage of the polypeptide precursor proopiomelanocortin (POMC), which also results in several other cleavage products including MSH, ACTH, and beta endorphin. ATCH is secreted from the anterior pituitary in response to the corticotropin-releasing hormone from the hypothalamus. It stimulates the secretion of glucocorticoids like cortisol, but has little control over the stimulation of mineralocorticoids like aldosterone, which is another major hormone of the adrenal cortex.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: adrenal corticotropic hormone; adrenocorticotropic hormone; adrenocorticotropin; alpha-melanocyte stimulating hormone; alpha-melanocyte-stimulating hormone; alpha-MSH; beta-endorphin; beta-LPH; beta-melanocyte-stimulating hormone; beta-MSH; corticotropin-like intermediary peptide; Corticotropin-lipotropin; gamma-LPH; gamma-MSH; lipotropin beta; lipotropin gamma; melanotropin alpha; melanotropin beta; melanotropin gamma; met-enkephalin; opiomelanocortin prepropeptide; OTTHUMP00000119991; OTTHUMP00000200964; POMC; Precursor of MSH; pro-ACTH-endorphin; Pro-opiomelanocortin; pro-opiomelanocortin-alpha; proopiomelanocortin (adrenocorticotropin/ beta-lipotropin/ alpha-melanocyte stimulating hormone/ beta-melanocyte stimulating hormone/ beta-endorphin); proopiomelanocortin preproprotein; proopiomelanocortin, beta (endorphin, beta); proopoimelanocortin, beta (endorphin, beta)

          View more View less

          Gene Aliases: ACTH; alpha-MSH; alphaMSH; BE; Beta-LPH; beta-MSH; CLIP; Gamma-LPH; gamma-MSH; LPH; MSH; NPP; POC; POMC; Pomc-1; Pomc1; Pomc2

          View more View less

          UniProt ID: (Human) P01189, (Mouse) P01193

          View more View less

          Entrez Gene ID: (Human) 5443, (Mouse) 18976, (Rat) 24664

          View more View less

          Function(s)
          G-protein coupled receptor binding receptor binding hormone activity neuropeptide hormone activity type 3 melanocortin receptor binding type 4 melanocortin receptor binding type 1 melanocortin receptor binding molecular_function
          Process(es)
          generation of precursor metabolites and energy signal transduction neuropeptide signaling pathway cell-cell signaling regulation of blood pressure regulation of appetite negative regulation of tumor necrosis factor production cellular pigmentation glucose homeostasis positive regulation of transcription from RNA polymerase II promoter regulation of glycogen metabolic process regulation of corticosterone secretion feeding behavior peptide hormone processing
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-845544bffd-zxsgg:80/100.66.135.11:80.
          git-commit: 2bb44be0f35b85de1c1d8e4f377b85e7a3a71488
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.32.0-2025.07.28-1.0