Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 3
AFF4 Antibody (MA5-49267) in WB
Western blot analysis of AFF4 using AFF4 antibody (Product # MA5-49267). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50 µg of sample under reducing conditions. Lane 1: human HELA whole cell lysates; Lane 2: human HEPG2 whole cell lysates; Lane 3: human CACO-2 whole cell lysates; Lane 4: human HEK293 whole cell lysates; Lane 5: human MDA-MB-453 whole cell lysates; Lane 6: human PANC-1 whole cell lysates; Lane 7: human SW620 whol... View More
Product Details
MA5-49267
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human
Host/Isotype
Mouse
/ IgG2b
Class
Monoclonal
Type
Antibody
Clone
8G12
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human AFF4 (6-53aa RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_3074925
Product Specific Information
Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Immunogen sequence is identical to the related mouse sequence.
Positive Control - WB: human HELA whole cell, human HEPG2 whole cell, human CACO-2 whole cell, human HEK293 whole cell, human MDA-MB-453 whole cell, human PANC-1 whole cell, human SW620 whole cell. Flow: 293T cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. A chromosomal translocation involving this gene and MLL gene on chromosome 11 is found in infant acute lymphoblastic leukemia with ins.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: AF4/FMR2 family member 4; AF4/FMR2 family, member 4; ALL1-fused gene from chromosome 5q31 protein; Major CDK9 elongation factor-associated protein; Protein AF-5q31
Gene Aliases: AF5Q31; AFF4; CHOPS; HSPC092; MCEF
UniProt ID: (Human) Q9UHB7
Entrez Gene ID: (Human) 27125
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support