Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 4
AKR1B10 Antibody (PA5-78751) in ICC/IF
Immunocytochemistry/Immunofluorescence analysis of AKR1B10 in A549 cells using AKR1B10 Polyclonal Antibody (Product # PA5-78751). Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and incubated with the primary antibody at 5 µg/mL. DyLight 488 conjugated goat anti-rabbit IgG was used as secondary antibody at 1:500 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter... View More
Product Details
PA5-78751
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human AKR1B10 (285-316aa EMATILSFNRNWRACNVLQSSHLEDYPFNAEY).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2745867
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human A549 whole cell, human HepG2 whole cell. IHC: human intestinal cancer tissue, human liver cancer tissue. ICC/IF: A549 cell.
Target Information
AKR1B10, a 316aa protein, catalyzes efficient reduction ofaliphatic and aromatic aldehydes. It the first cytosolic NADP (H)-dependent retinal reductase described in humans and is characterized by the presence of a novel NADP binding motif. Due to its ability to convert glucose to sorbitol, AKR1B10 may have a role in development of secondary diabetic complications.It is abundantly expressed in adrenal gland, small intestine and colon, with lower levels in liver, thymus, prostate, testis, and skeletal muscle and its levels are up regulated in certain cancers such as hepatocellular carcinoma.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Aldo-keto reductase family 1 member B10; aldo-keto reductase family 1, member B10 (aldose reductase); aldo-keto reductase family 1, member B11 (aldose reductase-like); Aldose reductase-like; aldose reductase-like 1; aldose reductase-like peptide; Aldose reductase-related protein; ARL-1; ARP; hARP; MGC14103; SI reductase; Small intestine reductase
Gene Aliases: AKR1B10; AKR1B11; AKR1B12; ALDRLn; ARL-1; ARL1; HIS; HSI
UniProt ID: (Human) O60218
Entrez Gene ID: (Human) 57016
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support