Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
ALDH1B1 Polyclonal Antibody
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 11
ALDH1B1 Antibody (PA5-95376) in ICC/IF
Immunocytochemistry analysis of ALDH1B1 using anti-ALDH1B1 antibody (Product # PA5-95376) . ALDH1B1 was detected in an immunocytochemical section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 5 μg/mL rabbit anti-ALDH1B1 antibody (Product # PA5-95376) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section wa... View More
Product Details
PA5-95376
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Non-human primate,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human ALDH1B1 (116-156aa RVYLASLETLDNGKPFQESYALDLDEVIKVYRYFAGWADK W).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2807179
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human HepG2 whole cell, human K562 whole cell, human A431 whole cell, human A549 whole cell, human U20S whole cell, human Hela whole cell, monkey COS-7 whole cell, rat liver tissue, rat testis tissue, rat RH35 whole cell, mouse brain tissue, mouse liver tissue. IHC: human colon cancer tissue, human colonic adenocarcinoma tissue, human endometrial adenocarcinoma tissue, human hepatocellular carcinoma tissue, human laryngeal squamous cell carcinoma tissue, mouse colon tissue, rat colon tissue. ICC/IF: A431 cell. Flow: HEL cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
Aldehyde dehydrogenases (ALDHs) mediate NADP+-dependent oxidation of aldehydes into acids during detoxification of alcohol-derived acetaldehyde, lipid peroxidation and metabolism of corticosteroids, biogenic amines and neurotransmitters. Alcohol drinking habits and cardiovascular disease risk factors may be associated with ALDH gene variants. ALDH1B1 (Aldehyde dehydrogenase family 1 member B1), also known as ALDH5 or ALDHX (Aldehyde dehydrogenase X, mitochondrial), is a 517 amino acid mitochondrial protein that is expressed in the liver, testis and to a lesser extent in brain. ALDH1B1 belongs to the aldehyde dehydrogenase family and may play a major role in ethanol detoxification.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: acetaldehyde dehydrogenase 5; aldehyde dehydrogenase 1 family, member B1; aldehyde dehydrogenase 1B1; Aldehyde dehydrogenase 5; Aldehyde dehydrogenase family 1 member B1; Aldehyde dehydrogenase X, mitochondrial; ALDH class 2; MGC2230
Gene Aliases: 2700007F14Rik; ALDH1B1; ALDH5; ALDHX
UniProt ID: (Human) P30837, (Mouse) Q9CZS1, (Rat) Q66HF8
Entrez Gene ID: (Human) 219, (Mouse) 72535, (Rat) 298079
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support