Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
ATP11C Polyclonal Antibody
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 4
ATP11C Antibody (PA5-143956) in ICC/IF
Immunocytochemistry analysis of ATP11C in U2OS cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. Samples were then incubated in ATP11C Polyclonal antibody (Product # PA5-143956) using a dilution of 2 μg/mL. DyLight®488 conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate... View More
Product Details
PA5-143956
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human ATP11C (QNHEIELTKVHVERNAMDGYRTLCVAFKEIAPDDYER).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Wet ice
RRID
AB_3075170
Product Specific Information
Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Positive Control - WB: human HEK293 whole cell, human K562 whole cell, human PC-3 whole cell, human Hela whole cell, human A549 whole cell. ICC/IF: U20S cell. Flow: A549 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
The ATP11C gene encodes a protein that belongs to the P4-ATPase family, specifically functioning as a phospholipid-transporting ATPase. ATP11C plays a critical role in the maintenance of phospholipid asymmetry across the cell membrane by transporting aminophospholipids from the outer leaflet to the inner leaflet of the plasma membrane. This activity is essential for various biological processes, including cell membrane integrity, cell signaling, and apoptosis. ATP11C is particularly important in hematopoiesis, influencing the development of B cells and red blood cells. Mutations or dysregulation in ATP11C can lead to disruptions in cell membrane dynamics and are associated with immunological disorders and anemia. Research on ATP11C continues to focus on its role in phospholipid transport and its implications for cellular function and disease, particularly in the context of blood-related disorders.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: ATPase class VI type 11C; ATPase IQ; ATPase, class VI, type 11C; P4-ATPase flippase complex alpha subunit ATP11C; Phospholipid-transporting ATPase IG; probable phospholipid-transporting ATPase IG
Gene Aliases: ATP11C; ATPIG; ATPIQ
UniProt ID: (Human) Q8NB49
Entrez Gene ID: (Human) 286410
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support