Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • Adenylate Kinase 1 Antibodies

          Invitrogen

          Adenylate Kinase 1 Polyclonal Antibody

          View all (39) Adenylate Kinase 1 antibodies

          Promotion

          View available promotion(s)

          Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite Adenylate Kinase 1 Polyclonal Antibody

          • Antibody Testing Data (7)
          Adenylate Kinase 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          Adenylate Kinase 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 7

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          Adenylate Kinase 1 Antibody (PA5-78748) in IHC (P)

          Immunohistochemistry (Paraffin) analysis of Adenylate Kinase 1 in paraffin-embedded section of human lung adenocarcinoma tissue using Adenylate Kinase 1 Polyclonal Antibody (Product # PA5-78748). Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with the primary antibody... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          Adenylate Kinase 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Adenylate Kinase 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Adenylate Kinase 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Adenylate Kinase 1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Adenylate Kinase 1 Antibody in Western Blot (WB)
          Adenylate Kinase 1 Antibody in Western Blot (WB)
          Adenylate Kinase 1 Antibody in Flow Cytometry (Flow)

          Product Details

          PA5-78748

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (IHC)

          2-5 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human AK1 (149-189aa RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2745864

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human Hela whole cell lysates, human SiHa whole cell lysates, rat heart tissue lysates, mouse lung tissue lysates, mouse heart tissue lysates. IHC: human colon cancer tissue, human lung adenocarcinoma tissue, mouse heart tissue, rat heart tissue. Flow: PC-3 cell.

          Target Information

          Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: Adenylate kinase isoenzyme 1; adenylate kinase isoenzyme 1 {ECO:0000255|HAMAP-Rule:MF_03171}; Adenylate monophosphate kinase; adenylate monophosphate kinase {ECO:0000255|HAMAP-Rule:MF_03171}; AK 1; AK 1 {ECO:0000255|HAMAP-Rule:MF_03171}; ATP-AMP transphosphorylase 1; ATP-AMP transphosphorylase 1 {ECO:0000255|HAMAP-Rule:MF_03171}; ATP:AMP phosphotransferase; ATP:AMP phosphotransferase {ECO:0000255|HAMAP-Rule:MF_03171}; cytosolic adenylate kinase; Myokinase; myokinase {ECO:0000255|HAMAP-Rule:MF_03171}; testis secretory sperm binding protein Li 58j

          View more View less

          Gene Aliases: Ak 1; Ak-1; AK1; B430205N08Rik; HTL-S-58j

          View more View less

          UniProt ID: (Human) P00568, (Mouse) Q9R0Y5, (Rat) P39069

          View more View less

          Entrez Gene ID: (Human) 203, (Mouse) 11636, (Rat) 24183

          View more View less

          Function(s)
          adenylate kinase activity nucleoside diphosphate kinase activity ATP binding nucleotide binding kinase activity transferase activity phosphotransferase activity, phosphate group as acceptor nucleobase-containing compound kinase activity
          Process(es)
          nucleoside diphosphate phosphorylation ADP biosynthetic process cell cycle arrest nucleoside triphosphate biosynthetic process nucleobase-containing small molecule interconversion AMP metabolic process ATP metabolic process nucleobase-containing compound metabolic process positive regulation of glucose transport phosphorylation inosine biosynthetic process nucleotide phosphorylation muscle organ development positive regulation of neuron maturation response to activity cerebellum development olfactory bulb development neuron differentiation response to estradiol response to testosterone response to drug adenine metabolic process
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-67c77f6dc7-n6nf2:80/100.66.135.186:80.
          git-commit: 545e792480003146e539d624bd2a21b51d198228
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.31.0-2025.06.23-1.0