Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Adenylate Kinase 1 Polyclonal Antibody
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 7
Adenylate Kinase 1 Antibody (PA5-78748) in IHC (P)
Immunohistochemistry (Paraffin) analysis of Adenylate Kinase 1 in paraffin-embedded section of human lung adenocarcinoma tissue using Adenylate Kinase 1 Polyclonal Antibody (Product # PA5-78748). Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with the primary antibody... View More
Product Details
PA5-78748
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human AK1 (149-189aa RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2745864
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human Hela whole cell lysates, human SiHa whole cell lysates, rat heart tissue lysates, mouse lung tissue lysates, mouse heart tissue lysates. IHC: human colon cancer tissue, human lung adenocarcinoma tissue, mouse heart tissue, rat heart tissue. Flow: PC-3 cell.
Target Information
Adenylate kinase is an enzyme involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate group among adinine nucleotides. Three isozymes of adenylate kinase have been identified in vertebrates, adenylate isozyme 1 (AK1), 2 (AK2) and 3 (AK3). AK1 is found in the cytosol of skeletal muscle, brain and erythrocytes, whereas AK2 and AK3 are found in the mitochondria of other tissues including liver and heart. AK1 was identified because of its association with a rare genetic disorder causing nonspherocytic hemolytic anemia where a mutation in the AK1 gene was found to reduce the catalytic activity of the enzyme.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Adenylate kinase isoenzyme 1; adenylate kinase isoenzyme 1 {ECO:0000255|HAMAP-Rule:MF_03171}; Adenylate monophosphate kinase; adenylate monophosphate kinase {ECO:0000255|HAMAP-Rule:MF_03171}; AK 1; AK 1 {ECO:0000255|HAMAP-Rule:MF_03171}; ATP-AMP transphosphorylase 1; ATP-AMP transphosphorylase 1 {ECO:0000255|HAMAP-Rule:MF_03171}; ATP:AMP phosphotransferase; ATP:AMP phosphotransferase {ECO:0000255|HAMAP-Rule:MF_03171}; cytosolic adenylate kinase; Myokinase; myokinase {ECO:0000255|HAMAP-Rule:MF_03171}; testis secretory sperm binding protein Li 58j
Gene Aliases: Ak 1; Ak-1; AK1; B430205N08Rik; HTL-S-58j
UniProt ID: (Human) P00568, (Mouse) Q9R0Y5, (Rat) P39069
Entrez Gene ID: (Human) 203, (Mouse) 11636, (Rat) 24183
nucleoside diphosphate phosphorylation
ADP biosynthetic process
cell cycle arrest
nucleoside triphosphate biosynthetic process
nucleobase-containing small molecule interconversion
AMP metabolic process
ATP metabolic process
nucleobase-containing compound metabolic process
positive regulation of glucose transport
phosphorylation
inosine biosynthetic process
nucleotide phosphorylation
muscle organ development
positive regulation of neuron maturation
response to activity
cerebellum development
olfactory bulb development
neuron differentiation
response to estradiol
response to testosterone
response to drug
adenine metabolic process
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support