Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Ataxin 1 Monoclonal Antibody (N76/8), PerCP
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 3
Ataxin 1 Antibody (MA5-45664) in ICC/IF
Immunocytochemistry/Immunofluorescence analysis using human neuroblastoma cells. Fixation involved 4% Formaldehyde for 15 min at RT. Samples were incubated with Ataxin 1 monoclonal antibody (Product # MA5-45664) at 1:100 for 60 min at RT, followed by Goat Anti-Mouse ATTO 488 at 1:200 for 60 min at RT. Counterstain used was Phalloidin Texas Red F-Actin stain; DAPI (blue) nuclear stain at 1:1,000, 1:5,000 for 60 min at RT, 5 min at RT. Localization: Cytoplasm, Nucleus. Magnification: 60X. (A) DAPI (blue) nuclear stain. (B) Phalloidin Texas R... View More
Product Details
MA5-45664
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Mouse
/ IgG2b
Class
Monoclonal
Type
Antibody
Clone
N76/8
Immunogen
Synthetic peptide amino acids 164-197 (ATTPSQRSQLEAYSTLLANMGSLSQAPGHKVEPP) of mouse Ataxin-1.
Conjugate
Excitation/Emission Max
482/675 nm
View spectra
Form
Liquid
Concentration
1 mg/mL
Purification
Protein G
Storage buffer
95.64mM phosphate/2.48mM MES, pH 7.4, with 0.5M EDTA
Contains
no preservative
Storage conditions
4°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2932118
Product Specific Information
Rat: 100% identity (34/34 amino acids identical). Human: 88% identity (30/34 amino acids identical).
1 µg/mL of MA5-45664 was sufficient for detection of Ataxin-1 in 20 µg of rat brain lysate by colorimetric immunoblot analysis using Goat anti-mouse IgG:HRP as the secondary antibody.|Detects approximately 85kDa.
This antibody was formerly sold as clone S76-8.
Target Information
The autosomal dominant cerebellar ataxias (ADCA) are a heterogeneous group of neurodegenerative disorders characterized by progressive degeneration of the cerebellum, brain stem and spinal cord. Clinically, ADCA has been divided into three groups: ADCA types I-III. ADCAI is genetically heterogeneous, with five genetic loci, designated spinocerebellar ataxia (SCA) 1, 2, 3, 4 and 6, being assigned to five different chromosomes. ADCAII, which always presents with retinal degeneration (SCA7), and ADCAIII often referred to as the `pure' cerebellar syndrome (SCA5), are most likely homogeneous disorders. Several SCA genes have been cloned and shown to contain CAG repeats in their coding regions. ADCA is caused by the expansion of the CAG repeats, producing an elongated polyglutamine tract in the corresponding protein. The expanded repeats are variable in size and unstable, usually increasing in size when transmitted to successive generations. The function of the ataxins is not known. This locus has been mapped to chromosome 6, and it has been determined that the diseased allele contains 41-81 CAG repeats, compared to 6-39 in the normal allele, and is associated with spinocerebellar ataxia type 1 (SCA1). At least two transcript variants encoding the same protein have been found for this gene.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: alternative ataxin1; Ataxin-1; OTTHUMP00000016065; spinocerebellar ataxia 1; spinocerebellar ataxia 1 homolog; Spinocerebellar ataxia type 1 protein; Spinocerebellar ataxia type 1 protein homolog
Gene Aliases: 2900016G23Rik; ATX1; ATXN1; C85907; D6S504E; ENSMUSG00000074917; Gm10786; SCA1
UniProt ID: (Human) P54253, (Mouse) P54254, (Rat) Q63540
Entrez Gene ID: (Human) 6310, (Mouse) 20238, (Rat) 25049
negative regulation of transcription from RNA polymerase II promoter
transcription, DNA-templated
regulation of transcription, DNA-templated
adult locomotory behavior
visual learning
negative regulation of phosphorylation
negative regulation of insulin-like growth factor receptor signaling pathway
negative regulation of transcription, DNA-templated
positive regulation of transcription from RNA polymerase II promoter
lung alveolus development
nuclear export
excitatory postsynaptic potential
positive regulation of glial cell proliferation
RNA processing
biological_process
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support