Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
BMI-1 Polyclonal Antibody
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 2
BMI-1 Antibody (PA5-95197) in WB
Western blot analysis of BMI1 in, Lane 1: human U2O whole cell lysates, Lane 2: human PC-3 whole cell lysates, Lane 3: human HEK293 whole cell lysates, Lane 4: human Caco-2 whole cell lysates. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50 µg of sample under reducing conditions. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. The membrane was blocked with 5% Non-fat Milk... View More
Product Details
PA5-95197
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Bmi1 (135-165aa IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2807002
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human U2O whole cell, human PC-3 whole cell, human HEK293 whole cell, human Caco-2 whole cell, rat brain tissue, mouse brain tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
Component of the Polycomb group (PcG) multiprotein PRC1 complex, a complex required to maintain the transcriptionally repressive state of many genes, including Hox genes, throughout development. PcG PRC1 complex acts via chromatin remodeling and modification of histones; it mediates monoubiquitination of histone H2A 'Lys-119', rendering chromatin heritably changed in its expressibility. In the PRC1 complex, it is required to stimulate the E3 ubiquitin-protein ligase activity of RNF2/RING2.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: B lymphoma Mo-MLV insertion region 1; B lymphoma Mo-MLV insertion region 1 homolog; BMI1 polycomb ring finger oncogene; BMI1 polycomb ring finger proto-oncogene; murine leukemia viral (bmi-1) oncogene homolog; Pcgf4 antibody; Polycomb complex protein BMI-1; polycomb group protein Bmi1; polycomb group ring finger 4; Polycomb group RING finger protein 4; RING finger protein 51; RP11-573G6.1
Gene Aliases: AW546694; Bmi-1; BMI1; flvi-2/bmi-1; FLVI2/BMI1; PCGF4; RNF51
UniProt ID: (Human) P35226, (Mouse) P25916
Entrez Gene ID: (Human) 648, (Rat) 307151, (Mouse) 12151
negative regulation of transcription from RNA polymerase II promoter
transcription, DNA-templated
segment specification
regulation of gene expression
covalent chromatin modification
protein sumoylation
hemopoiesis
negative regulation of gene expression, epigenetic
positive regulation of fibroblast proliferation
positive regulation of ubiquitin-protein transferase activity
skeletal system development
in utero embryonic development
DNA methylation
humoral immune response
brain development
histone acetylation
histone ubiquitination
rostrocaudal neural tube patterning
positive regulation of B cell proliferation
positive regulation of immature T cell proliferation in thymus
somatic stem cell division
embryonic skeletal system morphogenesis
embryonic skeletal system development
regulation of catalytic activity
cellular response to interleukin-1
cellular response to dexamethasone stimulus
negative regulation of apoptotic signaling pathway
regulation of transcription, DNA-templated
cellular process
chromatin modification
hematopoietic stem cell homeostasis
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support