Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
BMP5 Polyclonal Antibody, DyLight™ 488
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
Product Details
PA5-78877
Product Specifications
Species Reactivity
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL).
Conjugate
Excitation/Emission Max
492/519 nm
View spectra
Form
Liquid
Concentration
200 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 50% glycerol
Contains
0.02% sodium azide
Storage conditions
4°C, store in dark, DO NOT FREEZE!
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2745993
Product Specific Information
Positive Control - Flow: U20S cell.
Target Information
RB3 (Stathmin-4), encoded by STMN4 gene, is a neuron-specific homologue of the SCG10/stathmin family proteins, possessing a unique N-terminal membrane-associated domain and the stathmin-like domain at the C terminus, which promotes microtubule (MT) catastrophe and/or tubulin sequestering. Stathmin is a ubiquitous cytosolic phosphoprotein, preferentially expressed in the nervous system, and described as a relay integrating diverse intracellular signaling pathways. RB3 is consistently up-regulated in differentiated neuroblastoma cells, and stable expression of transfected RB3 could induce differentiation, suggesting a role of RB3 during neuroblastoma differentiation. Moreover, increased RB3 is a unique response protein in the stathmin-related proteins following optical nerve axotomy and RB3 may be a critical target for neurodegenerative diseases.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
How to use the Panel Builder
Watch the video to learn how to use the Invitrogen Flow Cytometry Panel Builder to build your next flow cytometry panel in 5 easy steps.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: BMP; BMP 5; BMP-5; bone morphogenenic protein-5; Bone morphogenetic protein; Bone morphogenetic protein 5; MGC34244
Gene Aliases: BMP5
UniProt ID: (Human) P22003
Entrez Gene ID: (Human) 653
skeletal system development
ossification
type B pancreatic cell development
pattern specification process
negative regulation of cell proliferation
negative regulation of epithelial to mesenchymal transition
positive regulation of pathway-restricted SMAD protein phosphorylation
negative regulation of steroid biosynthetic process
BMP signaling pathway
male genitalia development
negative regulation of aldosterone biosynthetic process
growth
regulation of apoptotic process
regulation of MAPK cascade
negative regulation of insulin-like growth factor receptor signaling pathway
positive regulation of transcription from RNA polymerase II promoter
positive regulation of epithelial cell proliferation
cartilage development
SMAD protein signal transduction
negative regulation of mononuclear cell migration
positive regulation of dendrite development
negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
negative regulation of cortisol biosynthetic process
positive regulation of DNA-dependent DNA replication
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support