Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Beta III Tubulin Polyclonal Antibody
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 13
Beta III Tubulin Antibody (PA5-80198) in ICC/IF
Immunocytochemistry/Immunofluorescence analysis of Beta III Tubulin in U2OS cells using Beta III Tubulin Polyclonal Antibody (Product # PA5-80198). Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and incubated with the primary antibody at 5 µg/mL. Cy3 conjugated goat anti-rabbit IgG was used as secondary antibody at 1:... View More
Product Details
PA5-80198
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Chicken,
Human,
Mouse,
Non-human primate,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Beta Tubulin (383-412aa EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2747312
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human SiHa whole cell, human 293T whole cell, human HepG2 whole cell, monkey COS-7 whole cell, chicken heart tissue, rat brain tissue, rat PC-12 whole cell, mouse brain tissue, mouse NIH/3T3 whole cell. IHC: human liver cancer tissue, human testicular germ cell tumor tissue. ICC/IF: U20S cell. Flow: SiHa cell.
Target Information
The betaIII-tubulin isoform is present dominantly in cells of neuronal origin and it is one of the earliest markers of neuronal differentiation. It is regarded as a specific probe for the cells of neuronal origin as well as for the tumours originating from these cells. The betaIII-tubulin is most abundant in cells of neuronal origin, but was also detected in Sertoli cells of the testis and transiently in non-neuronal embryonic tissues.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: beta 3 tubulin; beta tubulin 3; beta-4-tubulin; beta-tubulin class-III; betaIII-tubulin; class III beta-tubulin; MC1R; Neuron specific beta III Tubulin; Neuron-specific class III beta-tubulin; TUBB; tubulin beta; Tubulin beta-3; Tubulin beta-3 chain; Tubulin beta-4; Tubulin beta-4 chain; Tubulin beta-III; tubulin, beta 3 class III
Gene Aliases: 3200002H15Rik; beta-4; CDCBM; CDCBM1; CFEOM3; CFEOM3A; FEOM3; M(beta)3; M(beta)6; TUBB3; TUBB4
UniProt ID: (Human) Q13509, (Mouse) Q9ERD7, (Rat) Q4QRB4
Entrez Gene ID: (Chicken) 431043, (Human) 10381, (Mouse) 22152, (Rat) 246118
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support