Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
PA5-79511
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human IL7R alpha (278-315aa DHKKTLEHLCKKPRKNLNVSFNPESFLDCQIHRVDDIQ).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2746627
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: 22RV1 whole cell. Flow: U20S cell, U87 cell.
Target Information
CD127 (Interleukin-7, IL-7) is a glycoprotein involved in the regulation of lymphopoiesis. The response of cells to CD127 is dependent on the presence of the interleukin 7 receptor (IL7R); the active receptor is an alpha/gamma chain heterodimer. CD127 consists of an alpha chain and a gamma chain. The gamma(c) chain, which also associates with the interleukin-2 receptor, serves primarily to activate signal transduction by the IL7R complex, while the alpha chain of IL7R determines specific signaling events through its association with cytoplasmic signaling molecules. CD127 promotes the proliferation of precursor B cells, thymocytes, T cell progenitors, and mature CD4+ and CD8+ T cells. The biological effects of IL7 are mediated by the binding of IL7 to the specific cell surface receptor. Diseases associated with CD127 dysfunction include severe combined immunodeficiency and T cell negative/B cell negative/NK positive severe combined immunodeficiency.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CD127; CD127 antigen; CDw127; IL 7 receptor; IL 7R a; IL 7R subunit alpha; IL 7R α; IL 7Ra; IL 7Rα; IL-7 receptor subunit alpha; IL-7R; IL-7R subunit alpha; IL7 receptor; IL7 receptor subunit alpha; IL7R a; IL7R alpha; IL7R subunit alpha; IL7R α; IL7Rα; interleukin 7 receptor alpha chain; interleukin 7 receptor isoform H5-6; Interleukin-7 receptor subunit alpha; Interleukin7 receptor subunit alpha; MGC107557; sCD127; soluble IL 7 receptor; soluble IL 7R
Gene Aliases: CD127; CDW127; IL-7R-alpha; IL7R; IL7RA; ILRA
UniProt ID: (Human) P16871
Entrez Gene ID: (Human) 3575, (Rat) 294797
cell morphogenesis
negative regulation of T cell mediated cytotoxicity
immunoglobulin production
biological_process
regulation of cell size
positive regulation of gene expression
cell growth
cytokine-mediated signaling pathway
T cell differentiation
positive regulation of T cell differentiation in thymus
B cell proliferation
lymph node development
homeostasis of number of cells
regulation of DNA recombination
immune response
signal transduction
cell surface receptor signaling pathway
interleukin-7-mediated signaling pathway
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support