Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Product Details
PA5-94946
Product Specifications
Species Reactivity
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human CD18 (24-58aa, ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide, 0.05mg thimerosal
Storage conditions
Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2806752
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
CD18 integrin beta 2 subunit is a 90 kDa type I transmembrane protein expressed on all leucocytes. CD18 can combine with integrin molecules CD11a-c to form heterodimers at the cell surface, and these heterodimers are known to participate in the process of cell adhesion as well as cell-surface mediated signaling. CD18 forms heterodimers with four types of CD11 molecule to constitute leukocyte (beta2) integrins: alphaLbeta2 (CD11a/CD18, LFA-1), alphaMbeta2 (CD11b/CD18, Mac-1, CR3), alphaXbeta2 (CD11c/CD18) and alphaDbeta2 (CD11d/CD18). In most cases, the response mediated by the integrin is a composite of the functions of its individual subunits, and these integrins are essential for proper leukocyte migration, mediating intercellular contacts. Absence of CD18 leads to leukocyte adhesion deficiency-1, severe reduction of CD18 expression leads to the development of a psoriasiform skin disease. CD18 is also a target of Mannheimia (Pasteurella) haemolytica leukotoxin and is sufficient to mediate leukotoxin-mediated cytolysis. Defects in the CD18 gene are the cause of leukocyte adhesion deficiency type I (LAD1). Two transcript variants encoding the CD18 protein have been identified.
⚠WARNING: This product can expose you to chemicals including mercury, which is known to the State of California to cause birth defects or other reproductive harm. For more information go to www.P65Warnings.ca.gov.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CD18; cell surface adhesion glycoprotein (LFA-1/CR3/P150,959 beta subunit precursor); Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta; complement component 3 receptor 3 and 4 subunit; complement receptor C3 beta-subunit; Complement receptor C3 subunit beta; integrin beta chain, beta 2; Integrin beta-2; integrin, beta 2 (complement component 3 receptor 3 and 4 subunit); leukocyte cell adhesion molecule CD18; leukocyte-associated antigens CD18/11A, CD18/11B, CD18/11C
Gene Aliases: CD18; ITGB2; LAD; LCAMB; LFA-1; MAC-1; MF17; MFI7
UniProt ID: (Human) P05107
Entrez Gene ID: (Human) 3689
leukocyte migration involved in inflammatory response
phagocytosis
apoptotic process
inflammatory response
cell adhesion
leukocyte cell-cell adhesion
cell-matrix adhesion
integrin-mediated signaling pathway
cell-cell signaling
aging
regulation of cell shape
natural killer cell activation
extracellular matrix organization
neutrophil chemotaxis
receptor internalization
heterotypic cell-cell adhesion
toll-like receptor 4 signaling pathway
endodermal cell differentiation
receptor clustering
endothelial cell migration
cellular extravasation
positive regulation of nitric oxide biosynthetic process
positive regulation of angiogenesis
regulation of peptidyl-tyrosine phosphorylation
regulation of immune response
leukocyte migration
positive regulation of NF-kappaB transcription factor activity
cellular response to low-density lipoprotein particle stimulus
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support