Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • DPP4 Antibodies

          Invitrogen

          CD26 Polyclonal Antibody

          View all (69) DPP4 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite CD26 Polyclonal Antibody

          • Antibody Testing Data (2)
          CD26 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          CD26 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 2

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          CD26 Antibody (PA5-79165) in ICC/IF

          Immunofluorescence analysis of Dipeptidyl peptidase 4 was performed using 70% confluent log phase Hep G2 cells. The cells were fixed with 4% paraformaldehyde for 10 minutes, permeabilized with 0.1% Triton™ X-100 for 15 minutes, and blocked with 2% BSA for 1 hour at room temperature. The cells were labeled with CD26 Polyclonal Antibody (Product # PA5-79165) at 5 µg/mL in 0.1% BSA, incubated at 4 degree celsius overnight and then labeled with Donkey anti-Rabbit IgG (H+L) Highly Cross-Adsorbed Secondary Antibody, Alexa Fluor Plus 488 (Product... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          CD26 Antibody in Immunocytochemistry (ICC/IF)
          CD26 Antibody in Western Blot (WB)

          Product Details

          PA5-79165

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human CD26 (731-761aa QAMWYTDEDHGIASSTAHQHIYTHMSHFIKQ).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746281

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Target Information

          CD26 (dipeptidyl peptidase IV, DPP IV), adenosine deaminase (ADA) binding protein) is a homodimeric atypical serine protease belonging to the prolyl oligopeptidase family. CD26 is expressed on lymphocyte cells and is upregulated during T-cell activation. CD26 is also expressed on activated B cells and natural killer cells and abundantly on epithelia. CD26 is implicated in a variety of biological functions including T-cell activation, cell adhesion with extracellular matrix such as fibronectin or collagens, and in HIV infection. CD26 identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. Further, CD26 is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. Alterations in CD26 peptidase activity are characteristic of malignant transformation, and the enzymatic activity increases dramatically with tumor grade and severity. CD26 is expressed in various blood cell types, but also in cells that are histogenetically related to activated fibroblasts. Alterations in CD26 density have been reported on circulating monocytes and CD4+ T cells during rheumatoid arthritis and systemic lupus erythematosus.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: ADABP; ADCP-2; Adenosine deaminase complexing protein 2; Bile canaliculus domain-specific membrane glycoprotein; CD26; Dipeptidyl peptidase 4; Dipeptidyl peptidase IV; dipeptidyl-peptidase 4; dipeptidylpeptidase 4; dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2); DPP IV; DPP-IV; GP110 glycoprotein; T-cell activation antigen CD26; THAM; Thymocyte-activating molecule; TP103

          View more View less

          Gene Aliases: ADABP; ADCP2; CD26; Dpp-4; DPP4; DPPIV; THAM; TP103

          View more View less

          UniProt ID: (Human) P27487, (Mouse) P28843, (Rat) P14740

          View more View less

          Entrez Gene ID: (Human) 1803, (Mouse) 13482, (Rat) 25253

          View more View less

          Function(s)
          virus receptor activity protease binding serine-type endopeptidase activity receptor binding protein binding serine-type peptidase activity dipeptidyl-peptidase activity identical protein binding protein homodimerization activity aminopeptidase activity collagen binding peptidase activity hydrolase activity peptide binding
          Process(es)
          behavioral fear response response to hypoxia regulation of T cell mediated immunity proteolysis cell adhesion positive regulation of cell proliferation negative regulation of extracellular matrix disassembly T cell costimulation regulation of cell-cell adhesion mediated by integrin locomotory exploration behavior psychomotor behavior T cell activation endothelial cell migration viral entry into host cell establishment of localization
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-845544bffd-zxsgg:80/100.66.135.11:80.
          git-commit: 2bb44be0f35b85de1c1d8e4f377b85e7a3a71488
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.32.0-2025.07.28-1.0