Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • CD36 Antibodies

          Invitrogen

          CD36 Polyclonal Antibody

          View all (91) CD36 antibodies

          Promotion

          View available promotion(s)

          Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite CD36 Polyclonal Antibody

          • Antibody Testing Data (3)
          CD36 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          CD36 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 3

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          CD36 Antibody (PA5-95242) in IHC (P)

          Immunohistochemical analysis of Galectin 1 in paraffin-embedded section of human Lung cancer tissues. Heat mediated antigen retrieval was performed in citrate buffer (pH6, epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 1μg/mL rabbit anti-Galectin 1 antibody (Product # PA5-95242) overnight at 4°C. Biotinylated goat anti-... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          CD36 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          CD36 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          CD36 Antibody in Western Blot (WB)

          Product Details

          PA5-95242

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human CD36 (31-66aa DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807046

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: Rat Liver Tissue, Rat Cardiac Muscle Tissue, Mouse Liver Tissue, Mouse Cardiac Muscle Tissue, SMMC whole cell. IHC: Rat Spleen Tissue, human Lung cancer tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          CD36, also known as scavenger receptor class B member 3, is a protein that is expressed on the surface of various cell types, including macrophages, platelets, and adipocytes. It plays a role in lipid metabolism, inflammation, and atherosclerosis, and is involved in the recognition and uptake of various ligands such as oxidized low-density lipoproteins, long-chain fatty acids, and apoptotic cells. CD36 is also implicated in the pathogenesis of malaria. The protein encoded by this gene serves as a receptor for thrombospondin in platelets and various cell lines, and is the fourth major glycoprotein of the platelet surface. It binds to collagen, thrombospondin, anionic phospholipids, and oxidized LDL, and directly mediates cytoadherence of Plasmodium falciparum parasitized erythrocytes. Mutations in this gene cause platelet glycoprotein deficiency. Multiple alternatively spliced transcript variants have been found for this gene. Diseases associated with CD36 include Platelet Glycoprotein IV Deficiency and Coronary Heart Disease 7.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: adipocyte membrane protein; CD36; CD36 antigen (collagen type I receptor, thrombospondin receptor); CD36 molecule (thrombospondin receptor); cluster determinant 36; collagen type I receptor thrombospondin receptor; FAT; Fatty acid translocase; fatty acid transport protein; Glycoprotein IIIb; GPIIIB; GPIV; Leukocyte differentiation antigen CD36; PAS IV; PAS-4; PAS-4 protein; Platelet collagen receptor; Platelet glycoprotein 4; Platelet glycoprotein IV; scavenger receptor class B, member 3; SR-B3; Thrombospondin receptor

          View more View less

          Gene Aliases: BDPLT10; CD36; CHDS7; FAT; GP3B; GP4; GPIV; PASIV; SCARB3

          View more View less

          UniProt ID: (Human) P16671, (Mouse) Q08857

          View more View less

          Entrez Gene ID: (Human) 948, (Rat) 29184, (Mouse) 12491

          View more View less

          Function(s)
          low-density lipoprotein receptor activity protein binding high-density lipoprotein particle binding lipid binding low-density lipoprotein particle binding transforming growth factor beta binding thrombospondin receptor activity lipoteichoic acid receptor activity lipoprotein particle binding oleic acid binding
          Process(es)
          negative regulation of transcription from RNA polymerase II promoter positive regulation of cell-matrix adhesion antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent platelet degranulation MyD88-dependent toll-like receptor signaling pathway lipid metabolic process receptor-mediated endocytosis phagocytosis, recognition immune response cell adhesion cell surface receptor signaling pathway positive regulation of cytosolic calcium ion concentration nitric oxide mediated signal transduction blood coagulation positive regulation of macrophage derived foam cell differentiation positive regulation of cholesterol storage lipid storage cGMP-mediated signaling positive regulation of blood coagulation intestinal cholesterol absorption cholesterol transport receptor internalization positive regulation of interleukin-12 production positive regulation of interleukin-6 production positive regulation of tumor necrosis factor production response to lipid triglyceride transport plasma lipoprotein particle clearance low-density lipoprotein particle clearance response to stilbenoid toll-like receptor TLR6:TLR2 signaling pathway lipoprotein transport negative regulation of transcription factor import into nucleus positive regulation of I-kappaB kinase/NF-kappaB signaling apoptotic cell clearance negative regulation of growth of symbiont in host long-chain fatty acid import interleukin-1 beta secretion positive regulation of peptidyl-tyrosine phosphorylation defense response to Gram-positive bacterium intestinal absorption sensory perception of taste low-density lipoprotein particle mediated signaling positive regulation of phagocytosis, engulfment positive regulation of macrophage cytokine production positive regulation of ERK1 and ERK2 cascade cholesterol import response to fatty acid response to linoleic acid cellular response to lipopolysaccharide cellular response to lipoteichoic acid cellular response to low-density lipoprotein particle stimulus cellular response to hydroperoxide cellular response to diacyl bacterial lipopeptide positive regulation of NLRP3 inflammasome complex assembly amyloid fibril formation regulation of removal of superoxide radicals positive regulation of blood microparticle formation positive regulation of reactive oxygen species metabolic process regulation of energy homeostasis long-chain fatty acid metabolic process pattern recognition receptor signaling pathway negative regulation of systemic arterial blood pressure fatty acid metabolic process triglyceride metabolic process signal transduction response to nutrient response to mechanical stimulus negative regulation of gene expression response to activity fatty acid transport long-chain fatty acid transport plasma membrane long-chain fatty acid transport negative regulation of angiogenesis fatty acid oxidation response to estradiol cellular response to insulin stimulus response to drug positive regulation of MAPK cascade digestive tract development positive regulation of cytokine secretion response to growth hormone cellular response to bacterial lipopeptide transport regulation of transcription from RNA polymerase II promoter in response to oxidative stress
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-5d94444789-k2m5x:80/100.66.128.182:80.
          git-commit: ec3573d8beaf0fd412f2d0ea2dcb8dd14c74098c
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.31.0-2025.06.23-1.0