Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
CD46 Polyclonal Antibody
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 1
CD46 Antibody (PA5-95335) in WB
Western blot analysis of CD46 in mouse testis extract (lane 1) and NIH3T3 whole cell lysates (lane 2). Samples were incubated with CD46 polyclonal antibody (Product # PA5-95335) using a 0.5 µg/mL dilution. developed was performed using enhanced chemiluminescence (ECL).
Product Details
PA5-95335
Product Specifications
Species Reactivity
Mouse
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of mouse CD46 (46-76aa ELPRPFEAMELKGTPKLFYAVGEKIEYKCKK).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2807138
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: mouse testis tissue, NIH/3T3 whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
CD46 (MCP, membrane cofactor protein) is a multifunctional cell surface transmembrane protein that binds and inactivates C3b and C4b complement fragments, regulates T cell-induced inflammatory responses by either inhibiting (CD46-1 isoform) or increasing (CD46-2 isoform) the contact hypersensitivity reaction. CD46 also serves as a receptor for several human pathogens (both bacteria and viruses), and its ligation alteres T lymphocyte polarization toward antigen-presenting cells or target cells, inhibiting lymphocyte function. CD46 is a protector of placental tissue and is also expressed on the inner acrosomal membrane of spermatozoa.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CD46; Membrane cofactor protein; MGC26544
Gene Aliases: Cd46; Mcp
UniProt ID: (Mouse) O88174
Entrez Gene ID: (Mouse) 17221
T cell mediated immunity
proteolysis
single fertilization
regulation of Notch signaling pathway
positive regulation of gene expression
negative regulation of gene expression
interleukin-10 production
positive regulation of interleukin-10 production
sequestering of extracellular ligand from receptor
positive regulation of T cell proliferation
negative regulation of catalytic activity
positive regulation of memory T cell differentiation
positive regulation of regulatory T cell differentiation
negative regulation of complement activation
positive regulation of transforming growth factor beta production
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support