Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 1
CEP68 Antibody (PA5-79031) in WB
Western blot analysis of CEP68 in Lane 1: human HeLa whole cell lysate, Lane 2: human COLO-320 whole cell lysate, Lane 3: human SK-OV-3 whole cell lysate, Lane 4: human Jurkat whole cell lysate, Lane 5: rat heart tissue lysate, Lane 6: mouse heart tissue lysate using 50 µg (reducing conditions) per well. Electrophoresis was performed on 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours and protein was transferred to a nitrocellulose membrane at 150mA for 50-90 minutes. Sample was blocked with 5% Non-fat Milk/TBS ... View More
Product Details
PA5-79031
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human CEP68 (ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2746147
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human Hela whole cell, human COLO-320 whole cell, human SK-OV-3 whole cell, human Jurkat whole cell, rat heart tissue, mouse heart tissue.
Target Information
Centrosomal protein of 68 kDa is a protein that in humans is encoded by the CEP68 gene. It is mapped to chromosome 2. CEP68 is required for centrosome cohesion. It decorates fibres emanating from the proximal ends of centrioles. CEP68 and rootletin depend both on each other for centriole association, and both also require CEP250 for their function.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: centrosomal protein 68; centrosomal protein 68kDa; Centrosomal protein of 68 kDa; Cep68
Gene Aliases: 6030463E10Rik; AI481761; BC027174; CEP68; KIAA0582; RGD1309101
UniProt ID: (Human) Q76N32, (Mouse) Q8C0D9
Entrez Gene ID: (Human) 23177, (Rat) 289822, (Mouse) 216543
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support