Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 3
Cyclin T1 Antibody (MA5-49233) in WB
Western blot analysis of Cyclin T1 using Cyclin T1 antibody (Product # MA5-49233). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 µg of sample under reducing conditions. Lane 1: human Jurkat whole cell lysates; Lane 2: human Hela whole cell lysates; Lane 3: human SW620 tissue lysates; Lane 4: monkey COS-7 whole cell lysates. After electrophoresis, proteins were transferred to a nitrocellulose membrane at 150 mA for 50-90 minute... View More
Product Details
MA5-49233
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Non-human primate
Host/Isotype
Mouse
/ IgG2b
Class
Monoclonal
Type
Antibody
Clone
3B7
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Cyclin T1 (375-410aa QKQNSKSVPSAKVSLKEYRAKHAEELAAQKRQLENM).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_3074891
Product Specific Information
Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Immunogen sequence is different from the related mouse sequence by one amino acid.
Positive Control - WB: human Jurkat whole cell, human Hela whole cell, human SW620 tissue, monkey COS-7 whole cell. Flow: U20S cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
This gene encodes a member of the highly conserved cyclin C subfamily. The encoded protein tightly associates with cyclin-dependent kinase 9, and is a major subunit of positive transcription elongation factor b (p-TEFb). In humans, there are multiple forms of positive transcription elongation factor b, which may include one of several different cyclins along with cyclin-dependent kinase 9. The complex containing the encoded cyclin and cyclin-dependent kinase 9 acts as a cofactor of human immunodeficiency virus type 1 (HIV-1) Tat protein, and is both necessary and sufficient for full activation of viral transcription. This cyclin and its kinase partner are also involved in triggering transcript elongation through phosphorylation of the carboxy-terminal domain of the largest RNA polymerase II subunit. Overexpression of this gene is implicated in tumor growth. Alternative splicing results in multiple transcript variants.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CDK9-associated C-type protein; cyclin C-related protein; cyclin T1b; Cyclin-T1; CycT1; human immunodeficiency virus type 1 (HIV-1) expression (elevated) 1
Gene Aliases: CCNT; CCNT1; CYCT1; HIVE1
UniProt ID: (Human) O60563
Entrez Gene ID: (Human) 904
regulation of cyclin-dependent protein serine/threonine kinase activity
transcription from RNA polymerase II promoter
transcription elongation from RNA polymerase II promoter
protein phosphorylation
cell cycle
viral process
snRNA transcription from RNA polymerase II promoter
positive regulation by host of viral transcription
positive regulation of cyclin-dependent protein serine/threonine kinase activity
positive regulation of transcription from RNA polymerase II promoter
positive regulation of viral transcription
cell division
negative regulation of mRNA polyadenylation
positive regulation of phosphorylation of RNA polymerase II C-terminal domain
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support