Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Cytochrome P450 Reductase Monoclonal Antibody (7F5)
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 7
Cytochrome P450 Reductase Antibody (MA5-49218) in IHC (P)
Immunohistochemistry analysis of Cytochrome P450 Reductase in paraffin-embedded section of human esophageal squamous carcinoma tissue. Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. Samples were incubated with Cytochrome P450 Reductase Monoclonal antibody (Product # MA5-49218) using a dilution of 2 μg/mL ... View More
Product Details
MA5-49218
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human
Host/Isotype
Mouse
/ IgG2b
Class
Monoclonal
Type
Antibody
Clone
7F5
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human POR (633-668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Wet ice
RRID
AB_3074876
Product Specific Information
Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Immunogen sequence is different from the related mouse and rat sequences by five amino acids.
Positive Control - WB: human HepG2 whole cell, human A549 whole cell. IHC: human esophageal squamous carcinoma tissue, human liver cancer tissue, human lung cancer tissue, human placenta tissue. Flow: SiHa cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
This gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CCR; CPR; CY DKFZp686G04235; DKFZp686G04235; FLJ26468; NADPH Cytochrome; NADPH--cytochrome P450 reductase; NADPH-dependent cytochrome P450 reductase; P450 (cytochrome) oxidoreductase; P450 Reductase
Gene Aliases: CPR; CYPOR; P450R; POR
UniProt ID: (Human) P16435
Entrez Gene ID: (Human) 5447
NADPH-hemoprotein reductase activity
cytochrome-b5 reductase activity, acting on NAD(P)H
protein binding
nitric oxide dioxygenase activity
electron carrier activity
FMN binding
hydrolase activity
enzyme binding
[methionine synthase] reductase activity
iron-cytochrome-c reductase activity
flavin adenine dinucleotide binding
NADP binding
regulation of growth plate cartilage chondrocyte proliferation
xenobiotic metabolic process
response to nutrient
carnitine metabolic process
flavonoid metabolic process
internal peptidyl-lysine acetylation
fatty acid oxidation
positive regulation of chondrocyte differentiation
positive regulation of monooxygenase activity
response to drug
negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
nitrate catabolic process
positive regulation of cholesterol biosynthetic process
positive regulation of smoothened signaling pathway
nitric oxide catabolic process
oxidation-reduction process
negative regulation of lipase activity
demethylation
cellular response to follicle-stimulating hormone stimulus
cellular response to peptide hormone stimulus
positive regulation of steroid hormone biosynthetic process
cellular organofluorine metabolic process
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support