Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Cytokeratin 19 Polyclonal Antibody
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 25
Cytokeratin 19 Antibody (PA5-95304) in ICC/IF
Immunocytochemistry analysis of Cytokeratin 19 using anti-Cytokeratin 19 antibody (Product # PA5-95304) . Cytokeratin 19 was detected in a section of MCF-7 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-Cytokeratin 19 antibody (Product # PA5-95304) overnight at 4°C. Dy... View More
Product Details
PA5-95304
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2807107
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human placenta tissuehuman MCF-7 whole cell, human SW620 whole cell, human HepG2 whole cell, human PANC-1 whole cell, rat lung tissue, rat small intestine tissue, mouse lung tissue, mouse HEPA1-6 whole cell. IHC: human lung cancer tissues, human intestinal cancer tissues, mouse small intestine tissues, rat small intestine tissues, human lung cancer tissues, human bladder cancer tissue, human breast cancer tissue, human cervical cancer tissue, human ovarian cancer tissue, human pancreas cancer tissue, human stomach cancer tissue. ICC/IF: MCF-7 cell. Flow: MCF-7 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
Cytokeratin 19 is part of a subfamily of intermediate filament proteins and are characterized by a remarkable biochemical diversity, represented in human epithelial tissues by at least 20 different polypeptides. Cytokeratins range in molecular weight from 40-68 kDa and isoelectric pH between 4.9 - 7.8. The individual human cytokeratins are numbered 1 to 20. The various epithelia in the human body usually express cytokeratins which are not only characteristic of the type of epithelium, but also related to the degree of maturation or differentiation within an epithelium. Cytokeratin subtype expression patterns are used to an increasing extent in the distinction of different types of epithelial malignancies. The cytokeratin antibodies are not only of assistance in the differential diagnosis of tumors using immunohistochemistry on tissue sections, but are also a useful tool in cytopathology and flow cytometric assays. For example, cytokeratin 19 is not expressed in hepatocytes, therefore, it is useful in the identification of liver metastasis.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 40-kDa keratin intermediate filament; C K1CS; CK 19; CK-19; cytokeratin 19; Cytokeratin-19; K19; keratin 19, type I; keratin complex 1, acidic, gene 19; Keratin, type I cytoskeletal 19; keratin, type I, 40-kd; Keratin-19; MGC15366; Type I keratin Ka19
Gene Aliases: AI663979; CK19; EndoC; K19; K1CS; Ka19; Krt-1.19; Krt1-19; KRT19
UniProt ID: (Human) P08727, (Mouse) P19001, (Rat) Q63279
Entrez Gene ID: (Human) 3880, (Mouse) 16669, (Rat) 360626
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support