Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • Cytokeratin 19 Antibodies

          Invitrogen

          Cytokeratin 19 Polyclonal Antibody

          View all (167) Cytokeratin 19 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite Cytokeratin 19 Polyclonal Antibody

          • Antibody Testing Data (15)
          Cytokeratin 19 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          Cytokeratin 19 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 15

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          Cytokeratin 19 Antibody (PA5-95304) in ICC/IF

          Immunocytochemistry/Immunofluorescence analysis of Cytokeratin 19 in MCF-7 cells using Cytokeratin 19 Polyclonal Antibody (Product # PA5-95304). Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and incubated with the primary antibody at 2 µg/mL. DyLight 488 conjugated goat anti-rabbit IgG was used as secondary antibody ... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          Cytokeratin 19 Antibody in Immunocytochemistry (ICC/IF)
          Cytokeratin 19 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Cytokeratin 19 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Cytokeratin 19 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Cytokeratin 19 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Cytokeratin 19 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Cytokeratin 19 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Cytokeratin 19 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Cytokeratin 19 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Cytokeratin 19 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Cytokeratin 19 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Cytokeratin 19 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Cytokeratin 19 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Cytokeratin 19 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Cytokeratin 19 Antibody in Flow Cytometry (Flow)

          Product Details

          PA5-95304

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          0.5-1 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          2 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2807107

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human placenta tissuehuman MCF-7 whole cell, human SW620 whole cell, human HepG2 whole cell, human PANC-1 whole cell, rat lung tissue, rat small intestine tissue, mouse lung tissue, mouse HEPA1-6 whole cell. IHC: human lung cancer tissues, human intestinal cancer tissues, mouse small intestine tissues, rat small intestine tissues, human lung cancer tissues, human bladder cancer tissue, human breast cancer tissue, human cervical cancer tissue, human ovarian cancer tissue, human pancreas cancer tissue, human stomach cancer tissue. ICC/IF: MCF-7 cell. Flow: MCF-7 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          Cytokeratin 19 is part of a subfamily of intermediate filament proteins and are characterized by a remarkable biochemical diversity, represented in human epithelial tissues by at least 20 different polypeptides. Cytokeratins range in molecular weight from 40-68 kDa and isoelectric pH between 4.9 - 7.8. The individual human cytokeratins are numbered 1 to 20. The various epithelia in the human body usually express cytokeratins which are not only characteristic of the type of epithelium, but also related to the degree of maturation or differentiation within an epithelium. Cytokeratin subtype expression patterns are used to an increasing extent in the distinction of different types of epithelial malignancies. The cytokeratin antibodies are not only of assistance in the differential diagnosis of tumors using immunohistochemistry on tissue sections, but are also a useful tool in cytopathology and flow cytometric assays. For example, cytokeratin 19 is not expressed in hepatocytes, therefore, it is useful in the identification of liver metastasis.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: 40-kDa keratin intermediate filament; C K1CS; CK 19; CK-19; cytokeratin 19; Cytokeratin-19; K19; keratin 19, type I; keratin complex 1, acidic, gene 19; Keratin, type I cytoskeletal 19; keratin, type I, 40-kd; Keratin-19; MGC15366; Type I keratin Ka19

          View more View less

          Gene Aliases: AI663979; CK19; EndoC; K19; K1CS; Ka19; Krt-1.19; Krt1-19; KRT19

          View more View less

          UniProt ID: (Human) P08727, (Mouse) P19001, (Rat) Q63279

          View more View less

          Entrez Gene ID: (Human) 3880, (Mouse) 16669, (Rat) 360626

          View more View less

          Function(s)
          structural constituent of cytoskeleton protein binding structural constituent of muscle protein complex binding structural molecule activity
          Process(es)
          Notch signaling pathway viral process response to estrogen sarcomere organization cell differentiation involved in embryonic placenta development
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-845544bffd-zxsgg:80/100.66.135.11:80.
          git-commit: 2bb44be0f35b85de1c1d8e4f377b85e7a3a71488
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.32.0-2025.07.28-1.0