Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • DOG-1 Antibodies

          NeoBiotechnologies

          DOG-1/ANO1 (Marker for Gastrointestinal Stromal Tumors) Monoclonal Antibody (DG1/447, DOG-1.1)

          View all (71) DOG-1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite DOG-1/ANO1 (Marker for Gastrointestinal Stromal Tumors) Monoclonal Antibody (DG1/447, DOG-1.1)

          • Antibody Testing Data (1)
          DOG-1/ANO1 (Marker for Gastrointestinal Stromal Tumors) Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          DOG-1/ANO1 (Marker for Gastrointestinal Stromal Tumors) Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          DOG-1/ANO1 (Marker for Gastrointestinal Stromal Tumors) Antibody (55107-MSM3-P1ABX) in IHC (P)

          Formalin-fixed, paraffin-embedded human GIST stained with DOG-1 Monoclonal Antibody (DG1/447 +DOG1.1). {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          DOG-1/ANO1 (Marker for Gastrointestinal Stromal Tumors) Antibody in Immunohistochemistry (Paraffin) (IHC (P))

          Product Details

          55107-MSM3-P1ABX

          Applications
          Tested Dilution
          Publications

          Immunohistochemistry (Paraffin) (IHC (P))

          Assay-dependent
          -

          Immunohistochemistry (PFA fixed) (IHC (PFA))

          1-2 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human

          Host/Isotype

          Mouse / IgG1, kappa

          Class

          Monoclonal

          Type

          Antibody

          Clone

          DG1/447, DOG-1.1

          Immunogen

          Recombinant human DOG-1 protein (DG1/447) + A synthetic peptide from human DOG-1 protein (MSDFVDWVIPDIPKDISQQIHKEKVLMVELFMREEQDKQQLL-ETCMEKERQKDEPPCNHHNTKACPDSLGSP-APSHAYHGGVL), conjugated to a carrier protein (DOG-1.1).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Liquid

          Concentration

          1 mg/mL

          Purification

          Protein A/G

          Storage buffer

          PBS, pH 7.4

          Contains

          no preservative

          Storage conditions

          -20°C, Avoid Freeze/Thaw Cycles

          Shipping conditions

          Wet ice

          Target Information

          DOG-1, the novel marker, is expressed ubiquitously in gastrointestinal stromal tumors irrespective of kit or PDGFR alpha mutation status.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: anoctamin 1, calcium activated chloride channel; Anoctamin-1; Ca2+-activated Cl- channel; calcium activated chloride channel; Discovered on gastrointestinal stromal tumors protein 1; FLJ10261; oral cancer overexpressed 2; Oral cancer overexpressed protein 2; Transmembrane protein 16A; transmembrane protein 16A (eight membrane-spanning domains); Tumor-amplified and overexpressed sequence 2

          View more View less

          Gene Aliases: ANO1; DOG1; ORAOV2; TAOS2; TMEM16A

          View more View less

          UniProt ID: (Human) Q5XXA6

          View more View less

          Entrez Gene ID: (Human) 55107

          View more View less

          Function(s)
          calcium activated cation channel activity intracellular calcium activated chloride channel activity voltage-gated chloride channel activity chloride channel activity protein binding iodide transmembrane transporter activity protein dimerization activity
          Process(es)
          cation transport chloride transport phospholipase C-activating G-protein coupled receptor signaling pathway multicellular organism development iodide transport ion transmembrane transport cellular response to heat positive regulation of insulin secretion involved in cellular response to glucose stimulus detection of temperature stimulus involved in sensory perception of pain cation transmembrane transport chloride transmembrane transport regulation of anion transmembrane transport
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-845544bffd-zxsgg:80/100.66.135.11:80.
          git-commit: 2bb44be0f35b85de1c1d8e4f377b85e7a3a71488
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.32.0-2025.07.28-1.0