Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
DVL3 Polyclonal Antibody
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 1
DVL3 Antibody (PA5-114375) in WB
Western blot analysis of DVL3 in the following samples: Lane 1: rat brain tissue lysates, Lane 2: mouse brain tissue lysates. Samples consisting of 50 µg (reducing conditions) of protein was separated with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V, Resolving gel; 2-3 hrs.), transferred to a Nitrocellulose membrane (150mA, 50-90 min) and washed with TBS-0.1% Tween (3 times, 5 minutes/wash) and blocked with 5% Non-fat Milk/TBS (1.5 hrs., room temperature). The membrane was incubated in DVL3 polyclonal antibody (Product # PA5-114375) at a di... View More
Product Details
PA5-114375
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human Dishevelled 3 (397-434aa DTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMW L).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2884831
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat brain tissue, mouse brain tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
This gene is a member of a multi-gene family which shares strong similarity with the Drosophila disheveled gene, dsh. The Drosophila disheveled gene encodes a cytoplasmic phosphoprotein that regulates cell proliferation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: dishevelled 3 (homologous to Drosophila dsh); dishevelled 3, dsh homolog; dishevelled, dsh homolog 3; Dishevelled-3; DSH homolog 3; dvl-3; OTTHUMP00000210778; Segment polarity protein dishevelled homolog DVL-3
Gene Aliases: DRS3; DVL3; KIAA0208
UniProt ID: (Human) Q92997, (Mouse) Q61062
Entrez Gene ID: (Human) 1857, (Mouse) 13544, (Rat) 303811
positive regulation of protein phosphorylation
outflow tract septum morphogenesis
Wnt signaling pathway
intracellular signal transduction
non-canonical Wnt signaling pathway
non-canonical Wnt signaling pathway via JNK cascade
response to drug
positive regulation of JUN kinase activity
positive regulation of GTPase activity
positive regulation of transcription, DNA-templated
protein stabilization
canonical Wnt signaling pathway
Wnt signaling pathway, planar cell polarity pathway
negative regulation of canonical Wnt signaling pathway
cochlea morphogenesis
planar cell polarity pathway involved in neural tube closure
regulation of cellular protein localization
beta-catenin destruction complex disassembly
heart morphogenesis
multicellular organism development
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support