Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • EEF2 Antibodies

          Invitrogen

          EEF2 Monoclonal Antibody (5F5)

          View all (31) EEF2 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite EEF2 Monoclonal Antibody (5F5)

          • Antibody Testing Data (6)
          EEF2 Antibody in Flow Cytometry (Flow)
          Group 53 Created with Sketch.
          EEF2 Antibody in Flow Cytometry (Flow)
          Group 53 Created with Sketch.

          FIGURE: 1 / 6

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          EEF2 Antibody (MA5-49171) in Flow

          Flow cytometry analysis of EEF2 in HEPA1-6 cells using EEF2 Monoclonal Antibody (5F5) (Product # MA5-49171), shown in overlay histogram (blue line). To facilitate intracellular staining, cells were fixed with 4% paraformaldehyde and permeabilized with permeabilization buffer. The cells were blocked with 10% normal goat serum, and incubated with the primary antibody (1 μg/1x10^6 cells) for 30 min at 20°C. DyLight 488 conjugated goat anti-mouse IgG (5-10 µg/1x10^6 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control ... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          EEF2 Antibody in Flow Cytometry (Flow)
          EEF2 Antibody in Flow Cytometry (Flow)
          EEF2 Antibody in Flow Cytometry (Flow)
          EEF2 Antibody in Flow Cytometry (Flow)
          EEF2 Antibody in Flow Cytometry (Flow)
          EEF2 Antibody in Flow Cytometry (Flow)

          Product Details

          MA5-49171

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.25-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          2-5 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          5 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/10x^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Mouse / IgG1

          Class

          Monoclonal

          Type

          Antibody

          Clone

          5F5

          Immunogen

          A synthetic peptide corresponding to a sequence of human EEF2 (QTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_3074829

          Product Specific Information

          Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.

          Positive Control - WB: human Hela whole cell, human HEPG2 whole cell, human Jurkat whole cell, human U20S whole cell, rat PC-12 whole cell, mouse NIH/3T3 whole cell. IHC: human breast cancer tissue, human rectal cancer tissue, human liver cancer tissue, human rectal cancer tissue. ICC/IF: HEPG2 cell. Flow: HEPA1-6 cell, HL-60 cell, NRK cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          Catalyzes the GTP-dependent ribosomal translocation step during translation elongation. During this step, the ribosome changes from the pre-translocational (PRE) to the post-translocational (POST) state as the newly formed A-site-bound peptidyl-tRNA and P-site-bound deacylated tRNA move to the P and E sites, respectively. Catalyzes the coordinated movement of the two tRNA molecules, the mRNA and conformational changes in the ribosome.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: EF-2; Elongation factor 2; elongation factor-2; polypeptidyl-tRNA translocase

          View more View less

          Gene Aliases: EEF-2; EEF2; EF-2; EF2; SCA26

          View more View less

          UniProt ID: (Human) P13639, (Mouse) P58252, (Rat) P05197

          View more View less

          Entrez Gene ID: (Human) 1938, (Mouse) 13629, (Rat) 29565

          View more View less

          Function(s)
          p53 binding translation elongation factor activity GTPase activity protein binding GTP binding 5S rRNA binding protein kinase binding ribosome binding poly(A) RNA binding actin filament binding cadherin binding involved in cell-cell adhesion nucleotide binding translation activator activity
          Process(es)
          hematopoietic progenitor cell differentiation translation translational elongation positive regulation of translation response to ischemia skeletal muscle contraction aging glial cell proliferation response to fluoxetine peptidyl-diphthamide biosynthetic process from peptidyl-histidine response to estradiol response to endoplasmic reticulum stress skeletal muscle cell differentiation response to hydrogen peroxide response to ethanol response to folic acid cell-cell adhesion cellular response to brain-derived neurotrophic factor stimulus positive regulation of cytoplasmic translation
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-845544bffd-zxsgg:80/100.66.135.11:80.
          git-commit: 2bb44be0f35b85de1c1d8e4f377b85e7a3a71488
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.32.0-2025.07.28-1.0