Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
ELF1 Polyclonal Antibody
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}
{{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 1
ELF1 Antibody (PA5-79200) in WB
Western blot analysis of ELF1 in Lane 1: human HeLa whole cell lysate, Lane 2: human COLO-320 whole cell lysate, Lane 3: human A549 whole cell lysate, Lane 4: human PANC-1 whole cell lysate, Lane 5: human A431 whole cell lysate, Lane 6: human Jurkat whole cell lysate, Lane 7: human 293T whole cell lysate using 50 µg (reducing conditions) per well. Electrophoresis was performed on 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours and protein was transferred to a nitrocellulose membrane at 150mA for 50-90 minutes. ... View More
Product Details
PA5-79200
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human E74 like factor 1 (QPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDE).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2746316
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human Hela whole cell, human COLO-320 whole cell, human A549 whole cell, human PANC-1 whole cell, Human A431 whole cell, human Jurkat whole cell, human 293T whole cell.
Target Information
This gene encodes an E26 transformation-specific related transcription factor. The encoded protein is primarily expressed in lymphoid cells and acts as both an enhancer and a repressor to regulate transcription of various genes. Alternative splicing results in multiple transcript variants.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: E74-like factor 1; E74-like factor 1 (ets domain transcription factor); ELF 1; ETS-related transcription factor Elf-1; mElf 1; OTTHUMP00000018310
Gene Aliases: Elf-1; ELF1; mElf-1; p70; Sts1
UniProt ID: (Human) P32519, (Mouse) Q60775
Entrez Gene ID: (Human) 1997, (Mouse) 13709, (Rat) 85424
RNA polymerase II core promoter proximal region sequence-specific DNA binding
transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding
transcription factor activity, sequence-specific DNA binding
protein binding
DNA binding
sequence-specific DNA binding
RNA polymerase II transcription factor activity, sequence-specific DNA binding
regulation of cytokine production
transcription, DNA-templated
regulation of transcription, DNA-templated
transcription from RNA polymerase II promoter
cell differentiation
positive regulation of transcription, DNA-templated
positive regulation of transcription from RNA polymerase II promoter
negative regulation of T cell receptor signaling pathway
regulation of transcription from RNA polymerase II promoter
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support