Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • EpCAM (CD326) Antibodies

          Invitrogen

          EpCAM (CD326) Polyclonal Antibody

          Advanced Verification
          View all (274) EpCAM (CD326) antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite EpCAM (CD326) Polyclonal Antibody

          • Antibody Testing Data (4)
          • Advanced Verification (1)
          EpCAM (CD326) Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          EpCAM (CD326) Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 5

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          EpCAM (CD326) Antibody (PA5-79207) in IHC (P)

          Immunohistochemistry (Paraffin) analysis of EpCAM (CD326) in paraffin-embedded section of human colon cancer tissue using EpCAM (CD326) Polyclonal Antibody (Product # PA5-79207). Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with the primary antibody at a 2 µg/mL dil... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          EpCAM (CD326) Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          EpCAM (CD326) Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          EpCAM (CD326) Antibody in Western Blot (WB)
          EpCAM (CD326) Antibody in Western Blot (WB)
          EpCAM (CD326) Antibody

          Product Details

          PA5-79207

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          2-5 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -

          ELISA (ELISA)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147-189aa ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746323

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human CACO-2 whole cell, human MCF-7 whole cell. IHC: human colon cancer tissue. Flow: CACO-2 cell.

          Target Information

          Ep-CAM (epithelial adhesion molecule, epithelial specific antigen, ESA) is a transmembrane glycoprotein expressed in the epithelium with a molecular weight of approximately 40 kDa, which functions as an epithelial cell adhesion molecule. Ep-CAM functions as a homotypic calcium-independent cell adhesion molecule, and has a direct impact on cell cycle, proliferation and metabolism of epithelial cells and fibroblasts due to its ability to rapidly induce the proto-oncogene c-myc and the cell cycle regulating genes cyclin A and E. Ep-CAM mediates Ca2+-independent homotypic interactions. Formation of Ep-CAM-mediated adhesions have a negative regulatory effect on adhesions mediated by classic cadherins, which may have strong effects on the differentiation and growth of epithelial cells. Ep-CAM overexpression was suggested to be associated with enhanced epithelial proliferation. Ep-CAM is highly expressed in human carcinomas, and is a marker for tumors of epithelial lineage. Ep-CAM is expressed on baso-lateral cell surface in most simple epithelia and many carcinoma types. Also, Ep-CAM reportedly distinguishes adenocarcinomas from pleural mesotheliomas.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: Adenocarcinoma-associated antigen; CD326; Cell surface glycoprotein Trop-1; EGP; EGP314; Ep-CAM; Epithelial cell adhesion molecule; Epithelial cell surface antigen; Epithelial glycoprotein; Epithelial glycoprotein 314; hEGP314; human epithelial glycoprotein-2; KS 1/4 antigen; KSA; Major gastrointestinal tumor-associated protein GA733-2; membrane component, chromosome 4, surface marker (35kD glycoprotein); Tumor-associated calcium signal transducer 1

          View more View less

          Gene Aliases: DIAR5; EGP-2; EGP314; EGP40; EPCAM; ESA; GA733-2; HNPCC8; KS1/4; KSA; M1S2; M4S1; MIC18; MK-1; TACSTD1; TROP1

          View more View less

          UniProt ID: (Human) P16422

          View more View less

          Entrez Gene ID: (Human) 4072

          View more View less

          Function(s)
          protein binding protein complex binding cadherin binding involved in cell-cell adhesion
          Process(es)
          ureteric bud development positive regulation of cell proliferation signal transduction involved in regulation of gene expression negative regulation of apoptotic process positive regulation of transcription from RNA polymerase II promoter stem cell differentiation cell-cell adhesion negative regulation of cell-cell adhesion mediated by cadherin positive regulation of cell motility positive regulation of stem cell proliferation
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-bff4f7d6d-tmrcx:80/100.66.135.11:80.
          git-commit: 683fd26f943b2dde6a08880618459b58d20c3896
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.32.0-Offline