Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • FGF9 Antibodies

          Invitrogen

          FGF9 Polyclonal Antibody

          View all (12) FGF9 antibodies

          Promotion

          View available promotion(s)

          Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite FGF9 Polyclonal Antibody

          • Antibody Testing Data (1)
          FGF9 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          FGF9 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 1

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          FGF9 Antibody (PA5-79260) in WB

          Western blot analysis of FGF9 in, Lane 1: human COLO-320 whole cell lysates, Lane 2: rat brain tissue lysates, Lane 3: mouse brain tissue lysates. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50 µg of sample under reducing conditions. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. The membrane was blocked with 5% Non-fat Milk/ TBS for 1. 5 hour at RT. The membrane was in... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          FGF9 Antibody in Western Blot (WB)

          Product Details

          PA5-79260

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence of human FGF9 (DHLGQSEAGGLPRGPAVTDLDHLKGILRRRQLY).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746376

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human COLO-320 whole cell, rat brain tissue, mouse brain tissue.

          Target Information

          The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein was isolated as a secreted factor that exhibits a growth-stimulating effect on cultured glial cells. In nervous system, this protein is produced mainly by neurons and may be important for glial cell development. Expression of the mouse homolog of this gene was found to be dependent on Sonic hedgehog (Shh) signaling. Mice lacking the homolog gene displayed a male-to-female sex reversal phenotype, which suggested a role in testicular embryogenesis.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: elbow knee synostosis; FGF; FGF-9; Fibroblast growth factor; Fibroblast growth factor 9; fibroblast growth factor 9 (glia-activating factor); GAF; glia activating factor; Glia-activating factor; HBGF-9; Heparin-binding growth factor 9; M-FGF-9

          View more View less

          Gene Aliases: Eks; FGF-9; FGF9; GAF; HBFG-9; HBGF-9; SYNS3

          View more View less

          UniProt ID: (Human) P31371, (Rat) P36364, (Mouse) P54130

          View more View less

          Entrez Gene ID: (Human) 2254, (Rat) 25444, (Mouse) 14180

          View more View less

          Function(s)
          protein tyrosine kinase activity Ras guanyl-nucleotide exchange factor activity fibroblast growth factor receptor binding growth factor activity heparin binding 1-phosphatidylinositol-3-kinase activity phosphatidylinositol-4,5-bisphosphate 3-kinase activity receptor binding
          Process(es)
          negative regulation of transcription from RNA polymerase II promoter angiogenesis osteoblast differentiation positive regulation of mesenchymal cell proliferation chondrocyte differentiation protein import into nucleus cell-cell signaling positive regulation of cell proliferation fibroblast growth factor receptor signaling pathway male gonad development positive regulation of gene expression substantia nigra development negative regulation of Wnt signaling pathway male sex determination lung development embryonic limb morphogenesis positive regulation of vascular endothelial growth factor receptor signaling pathway positive regulation of activin receptor signaling pathway inner ear morphogenesis positive regulation of MAPK cascade positive regulation of smoothened signaling pathway regulation of timing of cell differentiation embryonic digestive tract development embryonic skeletal system development positive regulation of epithelial cell proliferation positive regulation of cell division positive regulation of cardiac muscle cell proliferation lung-associated mesenchyme development positive regulation of canonical Wnt signaling pathway cardiac left ventricle morphogenesis cardiac ventricle development multicellular organism development cell differentiation positive regulation of transcription, DNA-templated vasculogenesis involved in coronary vascular morphogenesis MAPK cascade eye development signal transduction regulation of phosphatidylinositol 3-kinase signaling peptidyl-tyrosine phosphorylation phosphatidylinositol-3-phosphate biosynthetic process positive regulation of GTPase activity phosphatidylinositol phosphorylation phosphatidylinositol-mediated signaling
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-5d94444789-f7m9l:80/100.66.129.252:80.
          git-commit: ec3573d8beaf0fd412f2d0ea2dcb8dd14c74098c
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.31.0-2025.06.23-1.0