Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
FIBB Polyclonal Antibody
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 4
FIBB Antibody (PA5-95396) in ICC/IF
Immunocytochemistry/Immunofluorescence analysis of FIBB in A549 cells using FIBB Polyclonal Antibody (Product # PA5-95396). Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and incubated with the primary antibody at 5 µg/mL. DyLight594 conjugated goat anti-rabbit IgG was used as secondary antibody at 1:500 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets a... View More
Product Details
PA5-95396
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human FGB (193-225aa TNLRVLRSILENLRSKIQKLESDVSAQMEYCRT).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2807199
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human HepG2 whole cell, rat kidney tissue, rat liver tissue, mouse kidney tissue, mouse liver tissue. ICC/IF: A549 cell. Flow: HepG2 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
FIBB is the beta component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including afibrinogenemia, dysfibrinogenemia, hypodysfibrinogenemia and thrombotic tendency.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: epididymis secretory sperm binding protein Li 78p; Fibrinogen beta chain; fibrinogen, B beta polypeptide; fibrinogen, beta polypeptide; Liver regeneration-related protein LRRG036/LRRG043/LRRG189; MGC104327; MGC120405
Gene Aliases: 2510049G14Rik; Ab1-181; Ab1-216; Ac1-581; FGB; HEL-S-78p
UniProt ID: (Human) P02675, (Rat) P14480, (Mouse) Q8K0E8
Entrez Gene ID: (Human) 2244, (Rat) 24366, (Mouse) 110135
adaptive immune response
platelet degranulation
cell-matrix adhesion
signal transduction
blood coagulation
extracellular matrix organization
plasminogen activation
positive regulation of heterotypic cell-cell adhesion
fibrinolysis
induction of bacterial agglutination
cellular protein complex assembly
cellular response to leptin stimulus
innate immune response
positive regulation of vasoconstriction
positive regulation of exocytosis
positive regulation of protein secretion
protein polymerization
response to calcium ion
positive regulation of ERK1 and ERK2 cascade
platelet aggregation
cellular response to interleukin-1
blood coagulation, fibrin clot formation
positive regulation of peptide hormone secretion
positive regulation of substrate adhesion-dependent cell spreading
negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
negative regulation of endothelial cell apoptotic process
immune system process
hemostasis
platelet activation
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support