Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 1
Fibrinogen alpha chain Antibody (PA5-114364) in WB
Western blot analysis of Fibrinogen alpha chain in the following samples: Lane 1: rat skeletal muscle tissue lysates, Lane 2: HEPG2 whole cell lysates. Samples consisting of 50 µg (reducing conditions) of protein was separated with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V, Resolving gel; 2-3 hrs.), transferred to a Nitrocellulose membrane (150mA, 50-90 min) and washed with TBS-0.1% Tween (3 times, 5 minut... View More
Product Details
PA5-114364
Product Specifications
Species Reactivity
Human,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human FGA (687-727aa RTWQDYKRGFGSLNDEGEGEFWLGNDYLHLLTQRGSVLRVE).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Wet ice
RRID
AB_2884821
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat skeletal muscle tissue, HEPG2 whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
Fibrinogen is a soluble protein found in blood plasma and is produced by the liver cells. The protein is a hexamer consisting of two sets of disulfide linked chains. Fibrinogen is essential for blood coagulation as the precursor of fibrin. It is converted to fibrin by the action of thrombin in the presence of calcium ions.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Fibrinogen a chain; Fibrinogen alpha; Fibrinogen alpha chain; Fibrinogen α chain; fibrinogen, A alpha polypeptide; fibrinogen, alpha polypeptide; Fibrinogenα chain
Gene Aliases: Ac1873; Fba5e; FGA; Fib2
UniProt ID: (Human) P02671
Entrez Gene ID: (Human) 2243, (Rat) 361969
adaptive immune response
platelet degranulation
protein complex assembly
acute-phase response
cell-matrix adhesion
signal transduction
blood coagulation
extracellular matrix organization
plasminogen activation
response to estradiol
response to genistein
positive regulation of heterotypic cell-cell adhesion
fibrinolysis
induction of bacterial agglutination
response to morphine
cellular protein complex assembly
cellular protein metabolic process
innate immune response
positive regulation of vasoconstriction
positive regulation of exocytosis
response to cycloheximide
positive regulation of protein secretion
protein polymerization
response to calcium ion
positive regulation of ERK1 and ERK2 cascade
platelet aggregation
cellular response to interleukin-6
cellular response to organic cyclic compound
blood coagulation, common pathway
blood coagulation, fibrin clot formation
positive regulation of peptide hormone secretion
liver regeneration
positive regulation of substrate adhesion-dependent cell spreading
negative regulation of extrinsic apoptotic signaling pathway via death domain receptors
cellular response to granulocyte colony-stimulating factor
negative regulation of endothelial cell apoptotic process
platelet activation
cellular response to cytokine stimulus
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support