Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
Fumarase Monoclonal Antibody (9D8)
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 10
Fumarase Antibody (MA5-33010) in ICC/IF
Immunofluorescence analysis of fumarate hydratase (mitochondrial) (FH) was performed using 70% confluent log phase untreated and hydroxyurea treated (5mM for 3 hr) HCT 116 cells. The cells were fixed with 4% paraformaldehyde for 10 minutes, permeabilized with 0.1% Triton™ X-100 for 10 minutes, and blocked with 2% BSA for 45 minutes at room temperature. The cells were labeled with Fumarase Monoclonal Antibody (9D8) (Product # MA5-33010) at 1:100 in 0.1% BSA, incubated at 4 degree celsius overnight and then labeled with Donkey anti-Mouse IgG... View More
Product Details
MA5-33010
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Non-human primate,
Rat
Host/Isotype
Mouse
/ IgG2a
Class
Monoclonal
Type
Antibody
Clone
9D8
Immunogen
A synthetic peptide corresponding to a sequence of human FH (YDKAAKIAKTAH KNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2802644
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: K562 whole cell, human placenta tissue, COS-7 whole cell, HL-60 whole cell, Caco-2 whole cell, U20S whole cell, A549 whole cell, rat thymus tissue, rat testicular tissue, rat stomach tissue, mouse testicular tissue, mouse kidney tissue, NIH3T3 whole cell. IHC: human intestinal cancer tissue, human lung cancer tissue, rat liver tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
The protein encoded by this gene is an enzymatic component of the tricarboxylic acid cycle, or Krebs cycle, and catalyzes the formation of L-malate from fumarate. It exists in both a cytosolic form and an N-terminal extended form, differing only in the translation start site used. The N-terminal extended form is targeted to the mitochondrion, where the removal of the extension generates the same form as in the cytoplasm. It is similar to some thermostable class II fumarases and functions as a homotetramer. Mutations in this gene can cause fumarase deficiency and lead to progressive encephalopathy.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: EF-3; Fumarase; fumarate hydratase 1; Fumarate hydratase, mitochondrial
Gene Aliases: FH; Fh-1; Fh1; FMRD; HLRCC; LRCC; MCL; MCUL1
UniProt ID: (Human) P07954, (Rat) P14408, (Mouse) P97807
Entrez Gene ID: (Human) 2271, (Rat) 24368, (Mouse) 14194
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support