Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 2
GADD45G Antibody (PA5-79295) in WB
Western blot analysis of GADD45G in Lane 1: rat brain tissue lysate, Lane 2: rat heart tissue lysate, Lane 3: rat testis tissue lysate, Lane 4: rat skeletal muscle tissue lysate, Lane 5: mouse brain tissue lysate, Lane 6: mouse heart tissue lysate, Lane 7: mouse testis tissue lysate, Lane 8: mouse skeletal muscle tissue lysate, using 50 µg (reducing conditions) per well. Electrophoresis was performed on 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours and protein was transferred to a nitrocellulose membrane at 1... View More
Product Details
PA5-79295
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human GADD45G (MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQ).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2746411
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat brain tissue, rat heart tissue, rat testis tissue, rat skeletal muscle tissue, mouse brain tissue, mouse heart tissue, mouse testis tissue, mouse skeletal muscle tissue, human Hela whole cell, human placenta tissue, human SW620 whole cell, human A549 whole cell, mouse NIH3T3 whole cell.
Target Information
GADD45G gene is a member of a group of genes whose transcript levels are increased following stressful growth arrest conditions and treatment with DNA-damaging agents. The protein encoded by this gene responds to environmental stresses by mediating activation of the p38/JNK pathway via MTK1/MEKK4 kinase. The GADD45G is highly expressed in placenta.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Cytokine-responsive protein CR6; DDIT-2; DNA damage-inducible transcript 2 protein; gadd-related protein, 17 kD; GADD45-gamma; GADD45gamma; growth arrest and DNA damage inducible; Growth arrest and DNA damage-inducible protein GADD45 gamma; growth arrest and DNA-damage-inducible 45 gamma; growth arrest and DNA-damage-inducible protein GADD45 gamma; growth arrest and DNA-damage-inducible, gamma; RP11-260L6.1
Gene Aliases: AI327420; C86281; CR6; DDIT2; GADD45G; GADD45gamma; GRP17; OIG37
UniProt ID: (Human) O95257, (Rat) Q9WTQ7
Entrez Gene ID: (Human) 10912, (Rat) 291005, (Mouse) 23882
activation of MAPKKK activity
apoptotic process
response to stress
multicellular organism development
cell differentiation
positive regulation of apoptotic process
positive regulation of JNK cascade
regulation of cell cycle
positive regulation of p38MAPK cascade
activation of MAPKK activity
negative regulation of protein kinase activity
interferon-gamma biosynthetic process
T-helper 1 cell differentiation
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support