Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
GNAQ Polyclonal Antibody
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 7
GNAQ Antibody (PA5-79318) in ICC/IF
Immunocytochemistry analysis of GNAQ using anti-GNAQ antibody (Product # PA5-79318). GNAQ was detected in a section of A431 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-GNAQ antibody (Product # PA5-79318)overnight at 4°C. DyLight®550 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visuali... View More
Product Details
PA5-79318
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Published species
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human GNAQ (102-138aa KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2746434
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human placenta tissue, human Jurkat whole cell, rat brain tissue, mouse brain tissue. IHC: mouse testis tissue, rat ovary tissue, human prostatic cancer tissue. ICC/IF: A431 cell. Flow: A431 cell.
Target Information
Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GTP for GDP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: G alpha q; guanine nucleotide binding protein (G protein), q polypeptide; guanine nucleotide binding protein alpha q subunit; guanine nucleotide binding protein, alpha q polypeptide; guanine nucleotide regulatory protein G alpha q; Guanine nucleotide-binding protein alpha-q; Guanine nucleotide-binding protein G(q) subunit alpha; heterotrimeric guanine nucleotide-binding protein alpha q subunit
Gene Aliases: 1110005L02Rik; 6230401I02Rik; AA408290; AW060788; CMC1; Dsk1; Dsk10; G-ALPHA-q; Galphaq; GAQ; GNAQ; Gq; GqI; SWS
UniProt ID: (Human) P50148, (Rat) P82471, (Mouse) P21279
Entrez Gene ID: (Human) 2776, (Rat) 81666, (Mouse) 14682
skeletal system development
action potential
negative regulation of protein kinase activity
adenylate cyclase-activating G-protein coupled receptor signaling pathway
activation of phospholipase C activity
G-protein coupled acetylcholine receptor signaling pathway
glutamate receptor signaling pathway
heart development
blood coagulation
phototransduction, visible light
entrainment of circadian clock
post-embryonic development
neuron remodeling
forebrain neuron development
platelet activation
regulation of catenin import into nucleus
maternal behavior
embryonic digit morphogenesis
positive regulation of GTPase activity
regulation of melanocyte differentiation
developmental pigmentation
protein stabilization
phospholipase C-activating dopamine receptor signaling pathway
G-protein coupled receptor signaling pathway
phospholipase C-activating G-protein coupled receptor signaling pathway
metabolic process
positive regulation of apoptotic process
negative regulation of apoptotic process
negative regulation of potassium ion transport
positive regulation of smooth muscle cell proliferation
signal transduction
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support