Invitrogen

GREM1 Polyclonal Antibody

View all (16) GREM1 antibodies

Promotion

View available promotion(s)

Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

Datasheet
Protocols
Questions & Answers
Datasheet
Protocols
Questions & Answers

Product Details

PA5-79324

Applications
Tested Dilution
Publications

Western Blot (WB)

0.1-0.5 µg/mL
-
Product Specifications

Species Reactivity

Human, Mouse, Rat

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Gremlin 1 (151-184aa TMMVTLNCPELQPPTKKKRVTRVKQCRCISIDLD).
View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Antigen affinity chromatography

Storage buffer

PBS with 4mg trehalose

Contains

no preservative

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

RRID

AB_2746440

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: human A549 whole cell, rat testis tissue, mouse testis tissue.

Target Information

In Xenopus, Gremlin belongs to a novel gene family that act as BMP antagonists in embryonic explants. The human homolog of Drm/Gremlin (CKTFS1B1) is localized on human chromosome 15q13--> q15. DRM-specific mRNA is expressed in different human tissues, including brain, ovary, intestine and colon. It has been suggested that down-regulation of DRM is associated with tumor progression, and support the hypothesis that human DRM may play an important role during both neuroembryological development and carcinogenesis.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

References (0)

Have you cited this product in a publication?
Let us know so we can reference it here.
Cite this product

Bioinformatics

Protein Aliases: Cell proliferation-inducing gene 2 protein; colorectal adenoma and carcinoma 1; Cysteine knot superfamily 1, BMP antagonist 1; DAN domain family member 2; Down-regulated in Mos-transformed cells protein; down-regulated in v-mos-transformed cells; gremlin 1 homolog, cysteine knot superfamily; gremlin 1, cysteine knot superfamily, homolog; gremlin 1-like protein; Gremlin-1; IHG-2; Increased in high glucose protein 2; increased in high glucose-2

View more View less

Gene Aliases: C15DUPq; CKTSF1B1; CRAC1; CRCS4; DAND2; DRM; DUP15q; Grem; GREM1; GREMLIN; HMPS; HMPS1; IHG-2; ld; MPSH; PIG2

View more View less

UniProt ID: (Human) O60565, (Rat) O35793, (Mouse) O70326

View more View less

Entrez Gene ID: (Human) 26585, (Rat) 50566, (Mouse) 23892

View more View less

Function(s)
cytokine activity protein binding morphogen activity transmembrane receptor protein tyrosine kinase activator activity BMP binding vascular endothelial growth factor receptor 2 binding receptor agonist activity heparan sulfate proteoglycan binding
Process(es)
cell morphogenesis angiogenesis branching involved in ureteric bud morphogenesis cell migration involved in sprouting angiogenesis positive regulation of receptor internalization negative regulation of leukocyte chemotaxis positive regulation of transcription from RNA polymerase II promoter involved in myocardial precursor cell differentiation mesenchymal to epithelial transition involved in metanephros morphogenesis apoptotic process signal transduction activation of transmembrane receptor protein tyrosine kinase activity cell-cell signaling positive regulation of cell proliferation organ morphogenesis proximal/distal pattern formation regulation of epithelial to mesenchymal transition collagen fibril organization negative regulation of cell growth embryonic limb morphogenesis negative regulation of bone mineralization negative regulation of BMP signaling pathway negative regulation of chondrocyte differentiation regulation of stress-activated MAPK cascade negative regulation of osteoblast proliferation positive regulation of NF-kappaB import into nucleus negative regulation of apoptotic process endothelial cell migration positive regulation of angiogenesis negative regulation of transcription, DNA-templated positive regulation of transcription, DNA-templated positive regulation of transcription from RNA polymerase II promoter negative regulation of bone remodeling determination of dorsal identity positive regulation of NF-kappaB transcription factor activity regulation of focal adhesion assembly positive regulation of telomerase activity limb development negative regulation of pathway-restricted SMAD protein phosphorylation ureteric bud formation positive regulation of protein tyrosine kinase activity signal transduction by p53 class mediator negative regulation of monocyte chemotaxis negative regulation of canonical Wnt signaling pathway positive regulation of branching involved in ureteric bud morphogenesis negative regulation of branching involved in ureteric bud morphogenesis negative regulation of osteoclast proliferation positive regulation of peptidyl-tyrosine autophosphorylation negative regulation of bone trabecula formation negative regulation of bone mineralization involved in bone maturation positive regulation of receptor activity positive regulation of cardiac muscle cell differentiation
guarantee_icon

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more
help_icon

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support