Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • GSTA1/A2/A3/A4/A5 Antibodies

          Invitrogen

          GSTA1/A2/A3/A4/A5 Polyclonal Antibody

          View all (2) GSTA1/A2/A3/A4/A5 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite GSTA1/A2/A3/A4/A5 Polyclonal Antibody

          Product Details

          PA5-79336

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          2-5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the N-terminus of human GSTA1/A2/A3/A4/A5 (63-97aa MKLVQTRAILNYIASKYNLYGKDIKERALIDM YIE).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 5mg BSA

          Contains

          0.05mg sodium azide

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746452

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human HCCT tissue, human HCCP tissue, rat liver tissue, rat RH35 whole cell, mouse liver tissue. IHC: mouse liver tissue, rat liver tissue.

          Target Information

          Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding these enzymes are known to be highly polymorphic. These genetic variations can change an individual's susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of some drugs. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver (hepatocytes) and kidney (proximal tubules). In addition to metabolizing bilirubin and certain anti-cancer drugs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity, thereby protecting the cells from reactive oxygen species and the products of peroxidation.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: 13-hydroperoxyoctadecadienoate peroxidase; Androst-5-ene-3,17-dione isomerase; GHS transferase; glutathione S-alkyltransferase A1; glutathione S-alkyltransferase A2; glutathione S-alkyltransferase A3; glutathione S-alkyltransferase A4; glutathione S-aralkyltransferase A2; glutathione S-aralkyltransferase A3; glutathione S-aralkyltransferase A4; glutathione S-aryltransferase A1; glutathione S-aryltransferase A2; glutathione S-aryltransferase A3; glutathione S-aryltransferase A4; glutathione S-transferase 2; Glutathione S-transferase 5.7; Glutathione S-transferase A1; Glutathione S-transferase A2; Glutathione S-transferase A3; glutathione S-transferase A3 subunit; Glutathione S-transferase A3-3; Glutathione S-transferase A4; Glutathione S-transferase A4-4; Glutathione S-transferase A5; Glutathione S-transferase A5-5; Glutathione S-transferase alpha-1; Glutathione S-transferase alpha-2; Glutathione S-transferase alpha-3; Glutathione S-transferase alpha-4; Glutathione S-transferase alpha-5; Glutathione S-transferase GT41A; glutathione S-transferase Ha subunit 1; Glutathione S-transferase Ya; glutathione S-transferase Ya subunit; Glutathione S-transferase Ya-1; Glutathione S-transferase Ya-2; Glutathione S-transferase Ya1; Glutathione S-transferase Ya3; Glutathione S-transferase Yc; Glutathione S-transferase Yc-1; Glutathione S-transferase Yc-2; glutathione S-transferase Yc1 subunit; glutathione S-transferase Yc2 subunit; Glutathione S-transferase Yk; glutathione transferase; glutathione transferase A4-4; glutathione transferase A5; glutathione transferase YA subunit; Glutathione-S-transferase alpha type (Ya); Glutathione-S-transferase alpha type (Yc?); glutathione-S-transferase, alpha type2; GST 1-1; GST 1a-1a; GST 1b-1b; GST 2-2; GST 5.7; GST 8-8; GST A1-1; GST A2-2; GST A3-3; GST A4-4; GST A5-5; GST AA; GST B; GST class-alpha member 1; GST class-alpha member 2; GST class-alpha member 3; GST class-alpha member 4; GST class-alpha member 5; GST HA subunit 1; GST HA subunit 2; GST K; GST Ya1; GST Ya2; GST Yc1; GST Yc2; GST Yk; GST-epsilon; GST-gamma; GSTA1-1; GSTA2-2; GSTA4-4; GTH1; GTH2; Ligandin; liver GST2; S-(hydroxyalkyl)glutathione lyase A1; S-(hydroxyalkyl)glutathione lyase A2; S-(hydroxyalkyl)glutathione lyase A3; S-(hydroxyalkyl)glutathione lyase A4; testicular tissue protein Li 80; testis tissue sperm-binding protein Li 59n; uncharacterized protein LOC100042314

          View more View less

          Gene Aliases: ENSMUSG00000074179; GST-epsilon; GST2; Gst2-1; Gst2-2; Gst2-3; GST5.7; Gsta; GSTA1; GSTA1-1; GSTA2; GSTA2-2; GSTA3; GSTA3-3; GSTA4; GSTA4-4; GSTA5; Gstc-2; Gstc2; Gstya; Gstyc; Gstyc1; Gstyc2; GTA2; GTA3; GTA4; GTH1; GTH2; mGsta4; OTTMUSG00000031890; Yc1; Yc2

          View more View less

          UniProt ID: (Human) P08263, (Human) P09210, (Human) Q16772, (Human) O15217, (Human) Q7RTV2, (Rat) P04904, (Mouse) P13745, (Rat) P00502, (Mouse) P10648, (Mouse) P30115, (Rat) P46418, (Rat) P14942, (Mouse) P24472, (Rat) P04903

          View more View less

          Entrez Gene ID: (Human) 2938, (Human) 2939, (Human) 2940, (Human) 2941, (Human) 221357, (Mouse) 100042314, (Rat) 24421, (Mouse) 14857, (Rat) 24422, (Mouse) 14858, (Mouse) 14859, (Rat) 494500, (Rat) 300850, (Mouse) 14860, (Rat) 494499

          View more View less

          Function(s)
          glutathione transferase activity glutathione peroxidase activity protein binding protein homodimerization activity molecular_function drug binding glutathione binding transferase activity
          Process(es)
          aging metabolic process xenobiotic catabolic process glutathione metabolic process epithelial cell differentiation response to nutrient levels response to drug xenobiotic metabolic process response to herbicide response to zinc ion response to nicotine cellular response to lithium ion glutathione derivative biosynthetic process linoleic acid metabolic process cellular oxidant detoxification aflatoxin catabolic process biological_process
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-8696d955b-mh7vc:80/100.66.135.11:80.
          git-commit: b6496d4449ebd8b46e03b29da6eff4841d0bfc13
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.32.0-Offline