Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
HMG4 Monoclonal Antibody (8H9)
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 7
HMG4 Antibody (MA5-36241) in ICC/IF
Immunocytochemistry analysis of HMG4 in HeLA cells. Antigen retrieval was performed with enzyme antigen retrieval (15 min). Samples were blocked with 10% goat serum and incubated in HMG4 monoclonal antibody (Product # MA5-36241) at a dilution of 2 µg/mL (overnight, 4°C), followed by DyLight 488 conjugated goat anti-mouse IgG (30 min, 37°C) and DAPI at a dilution of 1:100.
Product Details
MA5-36241
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Mouse
/ IgG2b
Class
Monoclonal
Type
Antibody
Clone
8H9
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human HMG4 (62-95aa EMAKADKVRYDREMKDYGPAKGGKKKKDPNAPKR).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Wet ice
RRID
AB_2884075
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human Hela whole cell, human Jurkat whole cell, human CACO-2 whole cell, human 293T whole cell, human THP-1 whole cell, human HepG2 whole cell, human MCF-7 whole cell, rat brain tissue, rat lung tissue, mouse kidney tissue, mouse brain tissue, mouse lung tissue, mouse ovary tissue. ICC/IF: Hela cell. Flow: Hela cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
HMGB3 belongs to the high mobility group protein superfamily. Like HMG1 and HMG2, HMGB3 contains DNA-binding HMG box domains and is classified into the HMG box subfamily. Members of the HMG box subfamily are thought to play a fundamental role in DNA replication, nucleosome assembly and transcription.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: high mobility group box 3; High mobility group protein 2a; High mobility group protein 4; High mobility group protein B3; high mobilty group protein 2A; high-mobility group (nonhistone chromosomal) protein 4; high-mobility group protein 4; HMG-2a; HMG-4; MGC90319
Gene Aliases: HMG-2a; HMG-4; HMG2A; HMG4; HMGB3; RGD1564407
UniProt ID: (Human) O15347, (Mouse) O54879
Entrez Gene ID: (Human) 3149, (Rat) 305373, (Mouse) 15354
chromatin remodeling
regulation of transcription, DNA-templated
negative regulation of B cell differentiation
negative regulation of myeloid cell differentiation
DNA recombination
transcription, DNA-templated
multicellular organism development
DNA geometric change
innate immune response
negative regulation of cell differentiation
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support