Invitrogen

HO-1 Polyclonal Antibody

FIGURE: 1 / 11

HO-1 Antibody (PA5-77833) in WB

Western blot was performed using HO-1 Polyclonal Antibody (Product # PA5-77833), and a 32 kDa band corresponding to HO-1 protein was observed across cell lines and tissues tested except MCF-7 which is reported to have low to negative expression. An increase in HO-1 expression was observed in HeLa cells on cobalt chloride treatment. Whole cell extracts (30 µg lysate) of HeLa (Lane 1), HeLa treated with Cobalt Chloride (500 µM for 24 hours) (Lane 2), PANC-1 (Lane 3), MIA PaCa-2 (Lane 4), K-562 (Lane 5), A549 (Lane 6), MCF7 (Lane 7), and tiss... View More

HO-1 Antibody in Western Blot, Immunohistochemistry (WB, IHC)

Product Image Gallery

HO-1 Antibody — Altered expression of proteins upon cell treatment demonstrates antibody specificity. Western blot using HO-1 Polyclonal Antibody (Product # PA5-77833) shows up-regulation of HO-1 protein in HeLa cells upon cobalt chloride treatment. {TM}

Product Details

PA5-77833

Applications

Tested Dilution

Publications

Western Blot (WB)

1:1,000

View 7 publications 7 publications

Immunohistochemistry (IHC)

View 1 publication 1 publication

Immunohistochemistry (PFA fixed) (IHC (PFA))

1:100

Immunocytochemistry (ICC/IF)

1:100

Product Specifications

Species Reactivity

Dog, Human, Mouse, Rat

Published species

Mouse, Rat

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

Human heme-oxygenase (HO-1) synthetic multiple antigenic peptide (aa. 1-30)1 : MERPQPDSMPQDLSEALKEATKEVHTQAEN

View immunogen

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Liquid

Concentration

1 mg/mL

Purification

Protein A

Storage buffer

PBS, pH 7.4, with 50% glycerol

Contains

0.09% sodium azide

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

AB_2735912

Product Specific Information

1 µg/mL of PA5-77833 was sufficient for detection of HO-1 in 10 µg of heat shocked HeLa cell lysate by colorimetric immunoblot analysis using Goat anti-rabbit IgG:HRP as the secondary antibody.|Detects approximately 32kDa.

Target Information

Heme oxygenase (HO) is a microsomal enzyme that catalyzes the oxidation of heme to the antioxidant molecules, biliverdin and carbon monoxide. HO consists of two homologous isozymes, an inducible HO-1 and a constitutively expressed HO-2. HO-1 is induced by a wide variety of stimuli including conditions of oxidative stress, inflammatory agents, transforming growth factor beta and heat shock. The increase in expression of HO-1 is thought to be a cellular defense mechanism against oxidative stress since elevated HO could eventually generate more bilirubin, an anti-oxidant.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Product References

Protective Effect of Fucoxanthin on Zearalenone-Induced Hepatic Damage through Nrf2 Mediated by PI3K/AKT Signaling.

Marine drugs

Ben Ammar R,Zahra HA,Abu Zahra AM,Alfwuaires M,Abdulaziz Alamer S,Metwally AM,Althnaian TA,Al-Ramadan SY

Published figure using HO-1 polyclonal antibody (Product # PA5-77833) in Western Blot

Mon Jul 03 00:00:00 UTC 2023

Protective effects of aloin on asthmatic mice by activating Nrf2/HO-1 pathway and inhibiting TGF-β/Smad2/3 pathway.

Allergologia et immunopathologia

Wu S,Xia Y,Yang C,Li M

PA5-77833 was used in Western Blot to investigate the effects and mechanism of aloin on the ovalbumin-treated mice.

Tue Jul 11 00:00:00 UTC 2023

Astragaloside IV protects against ischemia/reperfusion (I/R)-induced kidney injury based on the Keap1-Nrf2/ARE signaling pathway.

Translational andrology and urology

Su Y,Xu J,Chen S,Feng J,Li J,Lei Z,Qiao L,Wang Y,Zeng D

PA5-77833 was used in Immunohistochemistry and Western Blotting and Immunohistochemistry to investigate the protective effects of Astragaloside IV (AS-IV) on ischemia-reperfusion (I/R) renal injury based on the keap1-Nrf2/ARE signaling pathway.

Mon Aug 01 00:00:00 UTC 2022

Astragaloside IV protects against ischemia/reperfusion (I/R)-induced kidney injury based on the Keap1-Nrf2/ARE signaling pathway.

Translational andrology and urology

Su Y,Xu J,Chen S,Feng J,Li J,Lei Z,Qiao L,Wang Y,Zeng D

Mon Aug 01 00:00:00 UTC 2022

Astragaloside IV protects against ischemia/reperfusion (I/R)-induced kidney injury based on the Keap1-Nrf2/ARE signaling pathway.

Translational andrology and urology

Su Y,Xu J,Chen S,Feng J,Li J,Lei Z,Qiao L,Wang Y,Zeng D

Mon Aug 01 00:00:00 UTC 2022

Ruscogenin Protects Against Deoxynivalenol-Induced Hepatic Injury by Inhibiting Oxidative Stress, Inflammation, and Apoptosis Through the Nrf2 Signaling Pathway: An In vitro Study.

Saudi journal of medicine & medical sciences

Elsawy H,Rajendran P,Sedky AM,Alfwuaires M

Published figure using HO-1 polyclonal antibody (Product # PA5-77833) in Western Blot

Wed Oct 19 00:00:00 UTC 2022

Flavonoid-Conjugated Gadolinium Complexes as Anti-Inflammatory Theranostic Agents.

Antioxidants (Basel, Switzerland)

Yang BW,Yang S,Kim S,Baek AR,Sung B,Kim YH,Lee JT,Lee SY,Kim HK,Choi G,Park JA,Nam SW,Lee GH,Chang Y

Published figure using HO-1 polyclonal antibody (Product # PA5-77833) in Western Blot

Thu Dec 15 00:00:00 UTC 2022

Cardiac Protective Effect of Kirenol against Doxorubicin-Induced Cardiac Hypertrophy in H9c2 Cells through Nrf2 Signaling via PI3K/AKT Pathways.

International journal of molecular sciences

Alzahrani AM,Rajendran P,Veeraraghavan VP,Hanieh H

Published figure using HO-1 polyclonal antibody (Product # PA5-77833) in Western Blot

Tue Mar 23 00:00:00 UTC 2021

Kaempferol Inhibits Zearalenone-Induced Oxidative Stress and Apoptosis via the PI3K/Akt-Mediated Nrf2 Signaling Pathway: In Vitro and In Vivo Studies.

International journal of molecular sciences

Rajendran P,Ammar RB,Al-Saeedi FJ,Mohamed ME,ElNaggar MA,Al-Ramadan SY,Bekhet GM,Soliman AM

PA5-77833 was used in Western Blotting to demonstrate that kaempferol possesses notable hepatoprotective roles against zearalenone-induced damage, potentially through the stimulation of Nrf2/HO-1 cascades and PI3K/Akt signalling.

Mon Dec 28 00:00:00 UTC 2020

Kaempferol Inhibits Zearalenone-Induced Oxidative Stress and Apoptosis via the PI3K/Akt-Mediated Nrf2 Signaling Pathway: In Vitro and In Vivo Studies.

International journal of molecular sciences

Rajendran P,Ammar RB,Al-Saeedi FJ,Mohamed ME,ElNaggar MA,Al-Ramadan SY,Bekhet GM,Soliman AM

Mon Dec 28 00:00:00 UTC 2020

Bioinformatics

Protein Aliases: heat shock protein, 32-kD; heme orygenase 1; heme oxygenase (decycling) 1; heme oxygenase (decyclizing) 1; Heme oxygenase 1; hemoxygenase; HO-1; HSP32; P32 protein

View more View less

Gene Aliases: bK286B10; D8Wsu38e; Hemox; Heox; HEOXG; Hmox; HMOX1; HMOX1D; HO; HO-1; HO1; HSP32

View more View less

UniProt ID: (Human) P09601, (Rat) P06762, (Mouse) P14901

View more View less

Entrez Gene ID: (Human) 3162, (Dog) 442987, (Rat) 24451, (Mouse) 15368

View more View less

Function(s)

heme oxygenase (decyclizing) activity phospholipase D activity signal transducer activity protein binding enzyme binding heme binding protein homodimerization activity metal ion binding oxidoreductase activity

Process(es)

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

Learn more

HO-1 Polyclonal Antibody

HO-1 Antibody (PA5-77833) in WB

Product Details

PA5-77833

Western Blot (WB)

Immunohistochemistry (IHC)

Immunohistochemistry (PFA fixed) (IHC (PFA))

Immunocytochemistry (ICC/IF)

Species Reactivity

Published species

Host/Isotype

Class

Type

Immunogen

Conjugate

Form

Concentration

Purification

Storage buffer

Contains

Storage conditions

Shipping conditions

RRID

Product Specific Information

Target Information

Bioinformatics

Performance Guarantee

We're here to help

Your items have has been added!