Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
HSPA2 Monoclonal Antibody (4A4)
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 6
HSPA2 Antibody (MA5-33000) in ICC/IF
Immunocytochemistry analysis of HSPA2 using anti-HSPA2 antibody (Product # MA5-33000) . HSPA2 was detected in a section of PC-3 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 2μg/mL rabbit anti-HSPA2 antibody (Product # MA5-33000) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. V... View More
Product Details
MA5-33000
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Mouse
/ IgG1
Class
Monoclonal
Type
Antibody
Clone
4A4
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human HSPA2 (564-598aa KISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHK).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2802634
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human Hela whole cell, human MDA-MB-231 whole cell, human COLO-320 whole cell, human PANC-1 whole cellhuman HT1080 whole cell, human MDA-MB-453 whole cell, human HepG2 whole cell, rat lung tissue, rat liver tissue, rat kidney tissue, rat testicular tissue, mouse lung tissue, mouse liver tissue, mouse kidney tissue, mouse testicular tissue, mouse RAW2467 whole cell. IHC: human lung cancer tissue. ICC/IF: PC-3 cell. Flow: PC-3 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
In cooperation with other chaperones, Hsp70s stabilize preexistent proteins against aggregation and mediate the folding of newly translated polypeptides in the cytosol as well as within organelles. These chaperones participate in all these processes through their ability to recognize nonnative conformations of other proteins. They bind extended peptide segments with a net hydrophobic character exposed by polypeptides during translation and membrane translocation, or following stress-induced damage.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Heat shock 70 kDa protein 2; heat shock 70kD protein 2; heat shock 70kDa protein 2; Heat shock protein; Heat shock protein 70.2; heat shock protein alpha 2; Heat shock protein family A member 2; heat shock protein, 70 kDa 2; Heat shock-related 70 kDa protein 2; HSP; HST; Testis-specific heat shock protein-related; testis-specific heat shock protein-related gene hst70
Gene Aliases: 70kDa; Hcp70.2; HSP70-2; HSP70-3; HSP70.2; HSP70A2; HSPA2; Hspt70; Hst70
UniProt ID: (Human) P54652, (Rat) P14659, (Mouse) P17156
Entrez Gene ID: (Human) 3306, (Rat) 60460, (Mouse) 15512
response to unfolded protein
male meiosis
male meiosis I
spermatogenesis
spermatid development
response to heat
response to cold
positive regulation of cyclin-dependent protein serine/threonine kinase activity involved in G2/M transition of mitotic cell cycle
protein refolding
synaptonemal complex disassembly
negative regulation of inclusion body assembly
positive regulation of calcium-transporting ATPase activity
positive regulation of protein phosphorylation
multicellular organism development
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support