Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • IBA1 Antibodies

          Invitrogen

          IBA1 Polyclonal Antibody

          View all (53) IBA1 antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite IBA1 Polyclonal Antibody

          • Antibody Testing Data (2)
          IBA1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.
          IBA1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          Group 53 Created with Sketch.

          FIGURE: 1 / 2

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          IBA1 Antibody (PA5-95409) in IHC (P)

          Immunohistochemistry (Paraffin) analysis of IBA1 in paraffin-embedded section of human spleen tissue using IBA1 Polyclonal Antibody (Product # PA5-95409). Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with the primary antibody at a 2 µg/mL dilution overnight at 4°C. ... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          IBA1 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          IBA1 Antibody in Western Blot (WB)

          Product Details

          PA5-95409

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          2-5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1 (99-133aa ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Wet ice

          RRID

          AB_2807212

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human HEL whole cell, human THP-1 whole cell. IHC: human spleen tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

          Target Information

          Ionized calcium-binding adapter molecule 1 (IBA1), also known by its gene name AIF1, is a protein expressed predominantly by microglia in the brain and spinal cord. This protein belongs to the EF-hand calcium-binding protein family and plays a crucial role in microglial activation and migration in response to brain injury or neuroinflammation. IBA1's function is integral to microglial motility and phagocytic activity, facilitating the cellular response to pathogenic stimuli and promoting tissue homeostasis and repair in the central nervous system. IBA1 serves as a reliable marker for activated microglia in various neurological disorders, including Alzheimer's disease, Parkinson's disease, and multiple sclerosis, where increased expression correlates with disease progression and severity. The protein's structural features enable it to bind calcium ions, inducing conformational changes that activate signaling pathways essential for microglial function. Its expression is highly regulated by inflammatory cytokines, underpinning its role in neuroimmune responses. Due to its specific expression in microglia during pathological conditions, IBA1 is widely used in research as a marker to study microglial status and activity, and it remains a focal point for understanding microglial involvement in neurodegenerative diseases.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: AIF-1; Allograft inflammatory factor 1; DADB-70P7.8; DASS-82G15.2; Em:AF129756.17; Iba; interferon gamma responsive transcript; Ionized calcium-binding adapter molecule 1; Protein G1

          View more View less

          Gene Aliases: AIF-1; AIF1; G1; IBA1; IRT-1; IRT1

          View more View less

          UniProt ID: (Human) P55008

          View more View less

          Entrez Gene ID: (Human) 199

          View more View less

          Function(s)
          molecular_function calcium ion binding actin filament binding
          Process(es)
          microglial cell activation positive regulation of protein phosphorylation phagocytosis, engulfment inflammatory response negative regulation of gene expression positive regulation of muscle hyperplasia Rac protein signal transduction actin filament polymerization cellular response to extracellular stimulus cellular response to hormone stimulus positive regulation of T cell proliferation negative regulation of apoptotic process positive regulation of nitric oxide biosynthetic process positive regulation of smooth muscle cell proliferation negative regulation of smooth muscle cell proliferation response to axon injury actin filament bundle assembly response to glucocorticoid response to electrical stimulus cellular response to morphine cellular response to interferon-gamma cellular response to hydroperoxide negative regulation of smooth muscle cell chemotaxis positive regulation of smooth muscle cell chemotaxis positive regulation of monocyte chemotaxis ruffle assembly positive regulation of G1/S transition of mitotic cell cycle positive regulation of T cell migration
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-67f4cd694f-jv9gd:80/100.66.135.11:80.
          git-commit: 961b7666e63bcc533d6299fdd217d6a70bd96cf1
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.32.0-2025.07.28-1.0