Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
IBA1 Polyclonal Antibody
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 5
IBA1 Antibody (PA5-95409) in IHC (P)
Immunohistochemistry (Paraffin) analysis of IBA1 in paraffin-embedded section of human spleen tissue using IBA1 Polyclonal Antibody (Product # PA5-95409). Heat mediated antigen retrieval was performed in EDTA buffer (pH 8.0, epitope retrieval solution). The tissue section was blocked with 10% goat serum. The tissue section was then incubated with the primary antibody at a 2 µg/mL dilution overnight at 4°C. ... View More
Product Details
PA5-95409
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Iba1 (99-133aa ETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEK).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
no preservative
Storage conditions
-20°C
Shipping conditions
Wet ice
RRID
AB_2807212
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human HEL whole cell, human THP-1 whole cell. IHC: human spleen tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
AIF1 is induced by cytokines and interferon. It is thought to be involved in the negative regulation of growth of vascular smooth muscle cells, which contributes to the anti-inflammatory response to vessel wall trauma.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: AIF-1; Allograft inflammatory factor 1; DADB-70P7.8; DASS-82G15.2; Em:AF129756.17; Iba; interferon gamma responsive transcript; Ionized calcium-binding adapter molecule 1; Protein G1
Gene Aliases: AIF-1; AIF1; G1; IBA1; IRT-1; IRT1
UniProt ID: (Human) P55008
Entrez Gene ID: (Human) 199
microglial cell activation
positive regulation of protein phosphorylation
phagocytosis, engulfment
inflammatory response
negative regulation of gene expression
positive regulation of muscle hyperplasia
Rac protein signal transduction
actin filament polymerization
cellular response to extracellular stimulus
cellular response to hormone stimulus
positive regulation of T cell proliferation
negative regulation of apoptotic process
positive regulation of nitric oxide biosynthetic process
positive regulation of smooth muscle cell proliferation
negative regulation of smooth muscle cell proliferation
response to axon injury
actin filament bundle assembly
response to glucocorticoid
response to electrical stimulus
cellular response to morphine
cellular response to interferon-gamma
cellular response to hydroperoxide
negative regulation of smooth muscle cell chemotaxis
positive regulation of smooth muscle cell chemotaxis
positive regulation of monocyte chemotaxis
ruffle assembly
positive regulation of G1/S transition of mitotic cell cycle
positive regulation of T cell migration
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support