Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 2
ICA1 Antibody (PA5-79426) in WB
Western blot analysis of ICA1 using ICA1 Polyclonal Antibody (Product # PA5-79426). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel)/90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 30 µg of sample under reducing conditions. Lane 1: human SH-SY5Y whole cell lysates. Lane 2: human RT4 whole cell lysates. Lane 3: human MCF-7 whole cell lysates. Lane 4: human K562 whole cell lysates. Lane 5: rat pancreas tissue lysates. Lane 6: rat brain tissue lysates. Lane 7: mouse pancreas tissue ly... View More
Product Details
PA5-79426
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human ICA1 (243-276aa EKTSHTMAAIHESFKGYQPYEFTTLKSLQDPMKK).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2746542
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human SH-SY5Y whole cell, human RT4 whole cell, human MCF-7 whole cell, human K562 whole cell, rat pancreas tissue, rat brain tissue, mouse pancreas tissue, mouse brain tissue.
Target Information
This gene encodes a protein with an arfaptin homology domain that is found both in the cytosol and as membrane-bound form on the Golgi complex and immature secretory granules. This protein is believed to be an autoantigen in insulin-dependent diabetes mellitus and primary Sjogren's syndrome. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: 69 kDa islet cell autoantigen; diabetes mellitus type I autoantigen; ica1; ica1 {ECO:0000312|RGD:621465}; ICA69; ICAp69; Islet cell autoantigen 1; islet cell autoantigen 1 isoform; islet cell autoantigen 1, 69 kDa; islet cell autoantigen 1, 69kDa; Islet cell autoantigen p69; p69; testicular tissue protein Li 162
Gene Aliases: 69kDa; ICA1; ICA69; ICAp69
UniProt ID: (Human) Q05084, (Mouse) P97411
Entrez Gene ID: (Human) 3382, (Mouse) 15893, (Rat) 81024
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support