Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
IDH1 Polyclonal Antibody
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 9
IDH1 Antibody (PA5-95289) in ICC/IF
Immunocytochemistry analysis of IDH1 in paraffin-embedded A549 cell. Antigen retrieval was performed on the tissue using citrate buffer (pH 6, 20 min) and blocked with 10% goat serum. Samples were incubated with IDH1 polyclonal antibody (Product # PA5-95289) at a 1 µg/mL dilution, followed by biotinylated goat anti-rabbit IgG (30 min, 37°C), and developed with Strepavidin-Biotin-Complex and DAB.
Product Details
PA5-95289
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human IDH1 (381-413aa KGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAK).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2807093
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human Hela whole cell, human A549 whole cell, human HepG2 whole cell, human RT4 whole cell, human K562 whole cell, human CACO-2 whole cell, human SiHa whole cell, human A431 whole cell. IHC: Human Intestinal Cancer tissue, Mouse Testis tissue, Rat Testis tissue IHC-F: rat small intestine tissue. ICC/IF: A549 cell. Flow: HepG2 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
Isocitrate dehydrogenases catalyze the oxidative decarboxylation of isocitrate to 2-oxoglutarate. These enzymes belong to two distinct subclasses, one of which utilizes NAD(+) as the electron acceptor and the other NADP(+). Five isocitrate dehydrogenases have been reported: three NAD(+)-dependent isocitrate dehydrogenases, which localize to the mitochondrial matrix, and two NADP(+)-dependent isocitrate dehydrogenases, one of which is mitochondrial and the other predominantly cytosolic. Each NADP(+)-dependent isozyme is a homodimer. The protein encoded by this gene is the NADP(+)-dependent isocitrate dehydrogenase found in the cytoplasm and peroxisomes. It contains the PTS-1 peroxisomal targeting signal sequence. The presence of this enzyme in peroxisomes suggests roles in the regeneration of NADPH for intraperoxisomal reductions, such as the conversion of 2, 4-dienoyl-CoAs to 3-enoyl-CoAs, as well as in peroxisomal reactions that consume 2-oxoglutarate, namely the alpha-hydroxylation of phytanic acid. The cytoplasmic enzyme serves a significant role in cytoplasmic NADPH production.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Cytosolic NADP-isocitrate dehydrogenase; epididymis luminal protein 216; epididymis secretory protein Li 26; IDH; IDP; IDPc; isocitrate dehydrogenase 1 (NADP+); isocitrate dehydrogenase 1 (NADP+), soluble; Isocitrate dehydrogenase 1, soluble; Isocitrate dehydrogenase [NADP] cytoplasmic; NADP(+)-specific ICDH; NADP+-specific ICDH; NADP-dependent isocitrate dehydrogenase, cytosolic; NADP-dependent isocitrate dehydrogenase, peroxisomal; OTTHUMP00000206464; OTTHUMP00000206465; OTTHUMP00000206466; Oxalosuccinate decarboxylase
Gene Aliases: AI314845; AI788952; E030024J03Rik; HEL-216; HEL-S-26; Id-1; IDCD; IDH; Idh-1; IDH1; IDP; IDPC; PICD
UniProt ID: (Human) O75874, (Mouse) O88844, (Rat) P41562
Entrez Gene ID: (Human) 3417, (Mouse) 15926, (Rat) 24479
magnesium ion binding
isocitrate dehydrogenase (NADP+) activity
receptor binding
protein homodimerization activity
NADP binding
NAD binding
(R)-2-hydroxyglutarate dehydrogenase activity
cadherin binding involved in cell-cell adhesion
oxidoreductase activity
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
metal ion binding
glyoxylate cycle
tricarboxylic acid cycle
isocitrate metabolic process
2-oxoglutarate metabolic process
NADPH regeneration
glutathione metabolic process
response to oxidative stress
female gonad development
response to steroid hormone
regulation of phospholipid catabolic process
regulation of phospholipid biosynthetic process
cell-cell adhesion
response to organic cyclic compound
oxidation-reduction process
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support