Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • IFNAR1 Antibodies

          Invitrogen

          IFNAR1 Polyclonal Antibody

          View all (35) IFNAR1 antibodies
          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite IFNAR1 Polyclonal Antibody

          • Antibody Testing Data (2)
          IFNAR1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.
          IFNAR1 Antibody in Western Blot (WB)
          Group 53 Created with Sketch.

          FIGURE: 1 / 2

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          IFNAR1 Antibody (PA5-79441) in WB

          Western blot analysis of IFNAR1/Beta R1 in, Lane 1: human K562 whole cell lysates, Lane 2: human T-47D whole cell lysates, Lane 3: human A549 whole cell lysates, Lane 4: mouse brain tissue lysates, Lane 5: mouse testis tissue lysates, Lane 6: mouse stomach tissue lysates, Lane 7: mouse lung tissue lysates, Lane 8: mouse HEPA1-6 whole cell lysates, Lane 9: mouse kidney tissue lysates. Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with ... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          IFNAR1 Antibody in Western Blot (WB)
          IFNAR1 Antibody in Western Blot (WB)

          Product Details

          PA5-79441

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.1-0.5 µg/mL
          -
          Product Specifications

          Species Reactivity

          Human

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence in the middle region of human IFNAR1 (263-306aa HAFLKRNPGNHLYKWKQIPDCENVKTTQCVFPQNVFQKGIYLLR).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746557

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human A431 whole cell, human K562 whole cell, human HEL whole cell.

          Target Information

          Interferons are widely used therapeutic agents because of their anti tumor and antiviral effects and because of their modulatory effects on the immune system (Biron,2001, Kirkwood, 2002). These cytokines produce their effects by binding to the Type 1 Interferon-& Receptor (IFNAR1). Down regulation of this receptor plays a key role in determining the magnitude and duration of cytokine signaling. This down regulation is thought to be influenced by phosphorylation of Serine 535 and 539 in the IFNAR1 (Kumar et al., 2003).

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: alpha-type antiviral protein; beta-type antiviral protein; CRF2-1; Cytokine receptor class-II member 1; Cytokine receptor family 2 member 1; H3K1; IFN R1; IFN-alpha/beta receptor 1; IFN-alpha/betaR1; IFN-alpha/betaRalpha; IFN-R-1; IFNalpha/beta R1; IFNalpha/beta-Ralpha; IFNalpha/betaR1; IFNR1; interferon (alpha, beta and omega) receptor 1; Interferon alpha/beta receptor 1; interferon receptor 1; interferon-alpha/beta receptor alpha chain; interferon-beta receptor 1; Type I interferon receptor 1

          View more View less

          Gene Aliases: AVP; IFN-alpha-REC; IFNAR; IFNAR1; IFNBR; IFRC

          View more View less

          UniProt ID: (Human) P17181

          View more View less

          Entrez Gene ID: (Human) 3454

          View more View less

          Function(s)
          type I interferon receptor activity protein binding type I interferon binding
          Process(es)
          JAK-STAT cascade response to virus response to lipopolysaccharide positive regulation of interferon-beta production positive regulation of interferon-gamma production cellular response to interferon-alpha T cell activation type I interferon biosynthetic process positive regulation of transcription, DNA-templated positive regulation of interleukin-1 beta secretion regulation of peptidyl-tyrosine phosphorylation defense response to virus type I interferon signaling pathway regulation of type I interferon-mediated signaling pathway
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-7fd48b9cb8-69xq6:80/100.66.134.130:80.
          git-commit: fe0b5dd8e7a67b57f27a6e2d26c18f8954d91d59
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.30.1-2025.05.22-1.0