Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
IKAROS Polyclonal Antibody
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 7
IKAROS Antibody (PA5-95293) in ICC/IF
Immunocytochemistry analysis of Ikaros using anti-Ikaros2 antibody (Product # PA5-95293) . Ikaros was detected in a section of MCF-7 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 5μg/mL rabbit anti-Ikaros antibody (Product # PA5-95293) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with D... View More
Product Details
PA5-95293
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Ikaros (428-459aa LKEEHRAYDLLRAASENSQDALRVVSTSGEQM).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2807097
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: human Daudi whole cell. IHC: mouse spleen tissue, rat spleen tissue, human tonsil tissue. ICC/IF: MCF-7 cell. Flow: U937 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
DNA-binding protein IKAROS functions in the specification and the maturation of the T lymphocyte. It also interacts with a critical control element in the terminal deoxynucleotidyl transferase promoter as well as with the promoters for other genes expressed during early stages of B-cell and T-cell development.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CLL-associated antigen KW-6; DNA-binding protein Ikaros; hIk-1; IKAROS family zinc finger 1 (Ikaros); Ikaros family zinc finger protein 1; Lymphoid transcription factor LyF-1; protein phosphatase 1, regulatory subunit 92; zinc finger protein, subfamily 1A, 1 (Ikaros)
Gene Aliases: 5832432G11Rik; CVID13; hlk-1; Hs.54452; IK1; IKAROS; IKZF1; LyF-1; LYF1; mKIAA4227; PPP1R92; PRO0758; RGD1562979; Zfpn1a1; ZNFN1A1
UniProt ID: (Human) Q13422
Entrez Gene ID: (Human) 10320, (Mouse) 22778, (Rat) 305501
DNA binding
transcription factor activity, sequence-specific DNA binding
protein binding
transcription regulatory region DNA binding
metal ion binding
RNA polymerase II regulatory region sequence-specific DNA binding
transcriptional repressor activity, RNA polymerase II transcription regulatory region sequence-specific binding
sequence-specific DNA binding
protein heterodimerization activity
negative regulation of transcription from RNA polymerase II promoter
transcription, DNA-templated
cell cycle
mesoderm development
covalent chromatin modification
lymphocyte differentiation
erythrocyte differentiation
negative regulation of transcription, DNA-templated
positive regulation of transcription from RNA polymerase II promoter
natural killer cell differentiation
regulation of transcription, DNA-templated
regulation of transcription from RNA polymerase II promoter
transcription from RNA polymerase II promoter
hemopoiesis
B cell differentiation
T cell differentiation
forebrain development
positive regulation of multicellular organism growth
positive regulation of B cell differentiation
positive regulation of neutrophil differentiation
positive regulation of transcription, DNA-templated
lymph node development
thymus development
Peyer's patch development
gland development
positive regulation of NK T cell differentiation
retina development in camera-type eye
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support