Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
KV1.2 (KCNA2) Polyclonal Antibody
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 4
KV1.2 (KCNA2) Antibody (PA5-144086) in ICC/IF
Immunocytochemistry analysis of KV1.2 (KCNA2) in U2OS cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum. Samples were then incubated in KV1.2 (KCNA2) Polyclonal antibody (Product # PA5-144086) using a dilution of 2 μg/mL. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution ... View More
Product Details
PA5-144086
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Kv1.2 (466-499aa NNSNEDFREENLKTANCTLANTNYVNITKMLTDV).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_3075300
Product Specific Information
Adding 0.2 mL of distilled water will yield a concentration of 500 µg/mL.
Immunogen sequence is identical to the related mouse and rat sequences.
Positive Control - WB: Rat Kidney Tissue, Rat Brain Tissue, Mouse Brain Tissue, Mouse Kidney Tissue. ICC/IF: U20S cell. Flow: A431 cell, C6 cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
Kcna2 is a voltage-gated potassium channel (KV) that belongs to the 6-TM family of potassium channel and also comprises the Ca2+-activated Slo (actually 7-TM) and the Ca2+-activated SK subfamilies. The alpha-subunits contain a single pore-forming region and combine to form tetramers. Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. The diverse functions of potassium channels include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). The Kcna2 gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. Kcna2 contains six membrane-spanning domains with a shaker-type repeat in the fourth segment. Further, Kcna2 belongs to the delayed rectifier class, members of which allow nerve cells to efficiently repolarize following an action potential. The coding region of the Kcna2 gene is intronless, and the gene is clustered with genes KCNA3 and KCNA10 on chromosome 1. Diseases associated with KCNA2 include Epileptic Encephalopathy (Early Infantile, 32) and Undetermined Early-Onset Epileptic Encephalopathy.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: MK2; NGK1; Potassium (K+) channel protein alpha 2, voltage dependent; potassium channel, voltage gated shaker related subfamily A, member 2; potassium voltage gated channel shaker related subfamily member 2; Potassium voltage-gated channel subfamily A member 2; potassium voltage-gated channel, shaker-related subfamily, member 2; RAK; RBK2; RCK5; RP11-284N8.1; Voltage-gated K(+) channel HuKIV; Voltage-gated potassium channel HBK5; voltage-gated potassium channel protein Kv1.2; Voltage-gated potassium channel subunit Kv1.2
Gene Aliases: Akr6a4; BK2; EIEE32; ENSMUSG00000074335; Gm10672; HBK5; HK4; HUKIV; Kca1-2; KCNA2; KV1.2; Mk-2; MK2; NGK1; RBK2
UniProt ID: (Human) P16389, (Mouse) P63141, (Rat) P63142
Entrez Gene ID: (Human) 3737, (Mouse) 16490, (Rat) 25468
transport
ion transport
potassium ion transport
regulation of dopamine secretion
neuronal action potential
sensory perception of pain
optic nerve structural organization
regulation of ion transmembrane transport
regulation of circadian sleep/wake cycle, non-REM sleep
protein oligomerization
protein homooligomerization
transmembrane transport
potassium ion transmembrane transport
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support