Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 1
LIMK1 Antibody (PA5-79603) in WB
Western blot analysis of LIMK1 in Lane 1: rat brain tissue lysate, Lane 2: mouse gastric tissue lysate, Lane 3: HeLa whole cell lysate, Lane 4: U87 whole cell lysate, Lane 5: SKOV whole cell lysate using 40-50 µg per well. Sample was incubated with LIMK1 (Product # PA5-79603) at a dilution of 0.5 µg/mL.
Product Details
PA5-79603
Applications
Tested Dilution
Publications
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Published species
Mouse
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human LIMK1 (599-634aa KLEHWLETLRMHLAGHLPLGPQLEQLDRGFWETYRR).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2746718
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: Rat Brain Tissue, Mouse Gaster Tissue, HELA whole cell, U87 whole cell, SKOV whole cell.
Target Information
LIMK1 is a serine/threonine kinase involved in regulation of actin cytoskeletal changes via phosphorylation of cofilin. LIMK1 has also been implicated in brain development. LIM domains are highly conserved cysteine-rich structures containing 2 zinc fingers. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. LIMK1 is likely to be a component of an intracellular signaling pathway and may be involved in brain development. LIMK1 hemizygosity is implicated in the impaired visuospatial constructive cognition of Williams syndrome.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Bioinformatics
Protein Aliases: EC 2.7.11.1; kinase LIMK1; KIZ-1; LIM domain kinase 1; lim kinase 1; LIM motif-containing protein kinase; LIM motif-containing protein kinase 1; LIM-domain containing protein kinase 1; LIM-domain containing, protein kinase 1; LIMK-1
Gene Aliases: KIZ-1; LIMK; LIMK-1; LIMK1
UniProt ID: (Human) P53667, (Mouse) P53668
Entrez Gene ID: (Human) 3984, (Mouse) 16885, (Rat) 65172
protein phosphorylation
signal transduction
Rho protein signal transduction
nervous system development
actin cytoskeleton organization
positive regulation of actin filament bundle assembly
Fc-gamma receptor signaling pathway involved in phagocytosis
positive regulation of axon extension
negative regulation of ubiquitin-protein transferase activity
positive regulation of stress fiber assembly
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support