Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
FIGURE: 1 / 1
LIMK2 Antibody (PA5-95305) in WB
Western blot analysis of LIMK2 in Lane 1: mouse brain tissue lysate (50 µg), Lane 2: mouse liver tissue lysate (50 µg), Lane 3: mouse thymus tissue lysate (50 µg), Lane 4: mouse testis tissue lysate (50 µg), Lane 5: 293T whole cell lysate (40 µg), Lane 6: HeLa whole cell lysate (40 µg). Samples were incubated with LIMK2 polyclonal antibody (Product # PA5-95305).
Product Details
PA5-95305
Product Specifications
Species Reactivity
Human,
Mouse
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human LIM kinase 2 (596-635aa KLEDSFEALSLYLGELGIPLPAELEELDHTVSMQYGLTRD).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 5mg BSA
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2807108
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: Mouse Brain Tissue, Mouse Liver Tissue, Mouse Thymus Tissue, Mouse Testis Tissue, 293T whole cell, HELA whole cell.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
LIMK2 is a serine/threonine kinase involved in regulation of actin cytoskeletal changes via phosphorylation of cofilin. LIMK2 has also been implicated in brain development. Although zinc fingers usually function by binding to DNA or RNA, the LIM motif probably mediates protein-protein interactions. LIM kinase-1 and LIM kinase-2 belong to a small subfamily with a unique combination of 2 N-terminal LIM motifs and a C-terminal protein kinase domain. The protein encoded by LIMK2 is phosphorylated and activated by ROCK, a downstream effector of Rho, and the encoded protein, in turn, phosphorylates cofilin, inhibiting its actin-depolymerizing activity. It is thought that this pathway contributes to Rho-induced reorganization of the actin cytoskeleton. At least three transcript variants encoding different isoforms have been found for LIMK2.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: EC 2.7.11.1; kinase LIMK2; LIM domain kinase 2; LIM kinase 2; LIMK; LIMK 2; LIMK-1; LIMK-2; LIMK1; LINhp-2; OTTHUMP00000199483
Gene Aliases: Limk-2; LIMK2
UniProt ID: (Human) P53671, (Mouse) O54785
Entrez Gene ID: (Human) 3985, (Mouse) 16886
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support