Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • MBP Antibodies

          Invitrogen

          MBP Monoclonal Antibody (7D2)

          View all (65) MBP antibodies

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promotions']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.viewpromo']}}

          {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.promocode']}}: {{promo.promoCode}} {{promo.promoTitle}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}

          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite MBP Monoclonal Antibody (7D2)

          • Antibody Testing Data (4)
          MBP Antibody in Immunohistochemistry (IHC)
          Group 53 Created with Sketch.
          MBP Antibody in Immunohistochemistry (IHC)
          Group 53 Created with Sketch.

          FIGURE: 1 / 4

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          MBP Antibody (MA5-47468) in IHC

          Immunohistochemistry analysis of MBP in rat brain hippocampal section. Samples were stained with MBP monoclonal antibody (Product # MA5-47468) using a dilution of 1:5,000 (green). Costained with rabbit pAb to NF-M dilution 1:2,000, in red. The MBP antibody stains myelin sheathes around axons, while the NF-M antibody labels dendrites and axons of neuronal cells. {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          MBP Antibody in Immunohistochemistry (IHC)
          MBP Antibody in Immunohistochemistry (IHC)
          MBP Antibody in Western Blot (WB)
          MBP Antibody in Western Blot (WB)

          Product Details

          MA5-47468

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          1:5,000-1:10,000
          -

          Immunohistochemistry (IHC)

          1:2,000-1:5,000
          -

          Immunocytochemistry (ICC/IF)

          1:2,000-1:5,000
          -
          Product Specifications

          Species Reactivity

          Bovine, Horse, Human, Mouse, Pig, Rat

          Host/Isotype

          Mouse / IgG1

          Class

          Monoclonal

          Type

          Antibody

          Clone

          7D2

          Immunogen

          Purified myelin basic protein isolated from bovine brain, epitope maps to the peptide AEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLG, amino acids 145-184 of the human 21.5kDa sequence.
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Liquid

          Concentration

          1 mg/mL

          Purification

          Protein A/G

          Storage buffer

          PBS with 50% glycerol

          Contains

          5mM sodium azide

          Storage conditions

          Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2942450

          Target Information

          The protein encoded by the classic MBP gene is a major constituent of the myelin sheath of oligodendrocytes and Schwann cells in the nervous system. However, MBP-related transcripts are also present in the bone marrow and the immune system. These mRNAs arise from the long MBP gene (otherwise called "Golli-MBP") that contains 3 additional exons located upstream of the classic MBP exons. Alternative splicing from the Golli and the MBP transcription start sites gives rise to 2 sets of MBP-related transcripts and gene products. The Golli mRNAs contain 3 exons unique to Golli-MBP, spliced in-frame to 1 or more MBP exons. They encode hybrid proteins that have N-terminal Golli aa sequence linked to MBP aa sequence. The second family of transcripts contain only MBP exons and produce the well characterized myelin basic proteins. This complex gene structure is conserved among species suggesting that the MBP transcription unit is an integral part of the Golli transcription unit and that this arrangement is important for the function and/or regulation of these genes.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: 20 kDa microtubule-stabilizing protein; golli mbp; Golli-Mbp; myelin basic protein; Golli-Mbp; myelin basic protein; myelin basic protein S; MBP; MBP S; MGC99675; microtubule-stabilizing protein; Myelin A1 protein; Myelin basic protein; myelin basic protein Golli-mbp; myelin basic protein S; myelin deficient; Myelin membrane encephalitogenic protein; shiverer

          View more View less

          Gene Aliases: BOS_22097; C76307; golli-mbp; Hmbpr; MBP; Mbps; mld; R75289; Shi

          View more View less

          UniProt ID: (Human) P02686, (Rat) P02688, (Mouse) P04370

          View more View less

          Entrez Gene ID: (Human) 4155, (Pig) 414286, (Bovine) 618684, (Rat) 24547, (Mouse) 17196

          View more View less

          Function(s)
          protease binding protein binding structural constituent of myelin sheath
          Process(es)
          immune response chemical synaptic transmission central nervous system development aging axon ensheathment response to toxic substance substantia nigra development response to progesterone response to tumor necrosis factor myelination response to mercury ion negative regulation of axonogenesis membrane organization response to fatty acid
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-845544bffd-zxsgg:80/100.66.135.11:80.
          git-commit: 2bb44be0f35b85de1c1d8e4f377b85e7a3a71488
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.32.0-2025.07.28-1.0