Hamburger Menu Button
Thermo Fisher Scientific Logo
Sign in
Don't have an account ? Create Account
  • Products
    • Antibodies
    • Cell Culture Media
    • Chemicals
    • Chromatography Columns and Cartridges
    • Lab Equipment
    • Lab Plasticware and Supplies
    • Microplates
    • Oligos, Primers, Probes and Genes
    • TaqMan Real-Time PCR Assays
    • Greener Products
    • See all product categories
  • Applications
    • Bioprocessing
    • Cell Culture and Transfection
    • Cell and Gene Therapy
    • Chromatography
    • Molecular Testing
    • Digital Solutions
    • DNA and RNA Extraction and Analysis
    • Spectroscopy, Elemental and Isotope Analysis
    • See all applications and techniques
  • Services
    • 360° CDMO and CRO Solutions
    • CDMO Services
    • CRO Services
    • Custom Services
    • Enterprise Services
    • Financial and Leasing Services
    • Instrument Services
    • Lab Informatics
    • OEM and Commercial Supply
    • Training Services
    • Unity Lab Services
    • See all services
  • Help and Support
    • How to Order
    • Instrument Support
    • Learning Centers
    • Register for an Account
    • Technical Support Centers
    • See all help and support topics
  • Popular
    • TaqMan Real-Time PCR Assays
      TaqMan Real-Time PCR Assays
    • Antibodies
      Antibodies
    • Oligos, Primers & Probes
      Oligos, Primers & Probes
    • GeneArt Gene Synthesis
      GeneArt Gene Synthesis
    • Cell Culture Plastics
      Cell Culture Plastics
  • Contact Us
  • Quick Order
  • Order Status and Tracking
  • Documents and Certificates
Thermo Fisher Scientific Logo

Search Thermo Fisher Scientific

Search All
Search button Close
          • Order Status
          • Quick Order
          • Sign in
            Sign in
            Don't have an account ? Create Account
            • Account
            • Check Order Status
            • Aspire Member Program
            • Connect: Lab, Data, Apps
            • Custom Products & Projects
            • Services Central

          Disclaimer

          Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.

          • Primary Antibodies ›
          • MEK3 Antibodies

          Invitrogen

          MEK3 Polyclonal Antibody

          View all (89) MEK3 antibodies
          Datasheet
          Protocols
          Questions & Answers
          Datasheet
          Protocols
          Questions & Answers

          Cite MEK3 Polyclonal Antibody

          • Antibody Testing Data (6)
          MEK3 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.
          MEK3 Antibody in Immunocytochemistry (ICC/IF)
          Group 53 Created with Sketch.

          FIGURE: 1 / 6

          {{ $ctrl.currentElement.advancedVerification.fullName }}
          {{ $ctrl.currentElement.advancedVerification.text }}

          MEK3 Antibody (PA5-79626) in ICC/IF

          Immunocytochemistry analysis of MEK3 using anti-MEK3 antibody (Product # PA5-79626) . MEK3 was detected in an immunocytochemical section of CACO-2 cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent for 15 mins. The cells were blocked with 10% goat serum and then incubated with 4 μg/mL rabbit anti-MEK3 antibody (Product # PA5-79626) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counters... View More {{ $ctrl.currentElement.advancedVerification.fullName }} validation info. View more
          Published figure supplied by benchsci-logo
          PMID: {{$ctrl.currentElement.benchSciPubmedId}}
          View Product

          {{$ctrl.videoDesc}}

          {{$ctrl.videoLongDesc}}

          MEK3 Antibody in Immunocytochemistry (ICC/IF)
          MEK3 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          MEK3 Antibody in Immunohistochemistry (Paraffin) (IHC (P))
          MEK3 Antibody in Western Blot (WB)
          MEK3 Antibody in Western Blot (WB)
          MEK3 Antibody in Flow Cytometry (Flow)

          Product Details

          PA5-79626

          Applications
          Tested Dilution
          Publications

          Western Blot (WB)

          0.25-0.5 µg/mL
          -

          Immunohistochemistry (Paraffin) (IHC (P))

          2-5 µg/mL
          -

          Immunocytochemistry (ICC/IF)

          5 µg/mL
          -

          Flow Cytometry (Flow)

          1-3 µg/1x10^6 cells
          -
          Product Specifications

          Species Reactivity

          Human, Mouse, Rat

          Host/Isotype

          Rabbit / IgG

          Class

          Polyclonal

          Type

          Antibody

          Immunogen

          A synthetic peptide corresponding to a sequence at the C-terminus of human MEK3 (311-347aa AERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS).
          View immunogen

          Conjugate

          Unconjugated Unconjugated Unconjugated

          Form

          Lyophilized

          Concentration

          500 µg/mL

          Purification

          Antigen affinity chromatography

          Storage buffer

          PBS with 4mg trehalose

          Contains

          no preservative

          Storage conditions

          -20°C

          Shipping conditions

          Ambient (domestic); Wet ice (international)

          RRID

          AB_2746741

          Product Specific Information

          Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

          Positive Control - WB: human Hela whole cell, rat kidney tissue, mouse NIH/3T3 whole cell. IHC: human liver cancer tissue, human ovarian cancer tissue. ICC/IF: CACO-2 cell. Flow: CACO-2 cell.

          Target Information

          MAP2K3 (MEK3) is a dual-specificity protein kinase which acts in cellular signal transduction pathways, and is necessary for the expression of glucose transporter. It phosphorylates and thus activates MAPK14/p38-MAPK. This kinase can be activated by insulin, and is necessary for the expression of glucose transporter. Expression of RAS oncogene is found to result in the accumulation of the active form of this kinase, which thus leads to the constitutive activation of MAPK14, and confers oncogenic transformation of primary cells. The inhibition of this kinase is involved in the pathogenesis of Yersina pseudotuberculosis. Multiple alternatively spliced transcript variants that encode distinct isoforms have been reported for MEK3.

          For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

          References (0)

          Have you cited this product in a publication?
          Let us know so we can reference it here.
          Cite this product

          Bioinformatics

          Protein Aliases: Dual specificity mitogen-activated protein kinase kinase 3; EC 2.7.12.2; MAP kinase kinase 3; MAPK/ERK kinase 3; MAPKK 3; MEK 3; mitogen activated protein kinase kinase 3; protein kinase, mitogen-activated, kinase 3; SAPK kinase 2; Stress-activated protein kinase kinase 2

          View more View less

          Gene Aliases: AW212142; MAP2K3; MAPKK3; MEK3; MKK3; mMKK3b; PRKMK3; SAPKK-2; SAPKK2; SKK2

          View more View less

          UniProt ID: (Human) P46734, (Mouse) O09110

          View more View less

          Entrez Gene ID: (Human) 5606, (Mouse) 26397, (Rat) 303200

          View more View less

          Function(s)
          receptor signaling protein serine/threonine kinase activity MAP kinase kinase activity protein tyrosine kinase activity protein binding ATP binding protein kinase binding nucleotide binding protein kinase activity protein serine/threonine kinase activity kinase activity transferase activity transferase activity, transferring phosphorus-containing groups
          Process(es)
          MAPK cascade activation of MAPK activity protein phosphorylation inflammatory response regulation of mitotic cell cycle phosphorylation stress-activated protein kinase signaling cascade regulation of cytokine biosynthetic process regulation of apoptotic process positive regulation of protein kinase activity positive regulation of transcription, DNA-templated cardiac muscle contraction signal transduction peptidyl-tyrosine phosphorylation proteolysis in other organism positive regulation of protein phosphorylation response to ischemia heart development positive regulation of nitric-oxide synthase biosynthetic process cellular response to lipopolysaccharide cellular response to sorbitol
          It has to be done as per old AB suggested Products section.
          guarantee_icon

          Performance Guarantee

          If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

          Learn more
          help_icon

          We're here to help

          Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

          Contact tech support
          Ordering Plus Icon Minus Icon
          • Order Status
          • Order Help
          • Quick Order
          • Supply Center
          • eProcurement
          Support Plus Icon Minus Icon
          • Help and Support
          • Contact Us
          • Technical Support Centers
          • Documents and Certificates
          • Report a Site Issue
          Resources Plus Icon Minus Icon
          • Learning Centers
          • Promotions
          • Events and Webinars
          • Social Media
          About Thermo Fisher Plus Icon Minus Icon
          • About Us
          • Careers
          • Investors
          • News
          • Social Responsibility
          • Trademarks
          • Consumer Health Data Privacy Policy
          Our Portfolio Plus Icon Minus Icon
          • Thermo Scientific
          • Applied Biosystems
          • Invitrogen
          • Gibco
          • Ion Torrent
          • Fisher Scientific
          • Unity Lab Services
          • Patheon
          • PPD
          • Terms & Conditions
          • Privacy Information Center
          • Price & Freight Policy
          © 2006-2025 Thermo Fisher Scientific Inc. All rights reserved. All trademarks are the property of Thermo Fisher Scientific and its subsidiaries unless otherwise specified.
          United States flag icon
          United States

          Your items have has been added!


          Host server : magellan-search-7fd48b9cb8-69xq6:80/100.66.134.130:80.
          git-commit: fe0b5dd8e7a67b57f27a6e2d26c18f8954d91d59
          git-url: https://github.com/thermofisher/magellan-search
          git-branch: release/2.30.1-2025.05.22-1.0