Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
MMP13 Polyclonal Antibody
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 2
MMP13 Antibody (PA5-95401) in WB
Western blot analysis of MMP13 in Lane 1: human PC-3 whole cell lysates, Lane 2: human U20S whole cell lysates, Lane 3: human A549 whole cell lysates, Lane 4: human HEK293 whole cell lysates. Electrophoresis was performed with 5-20% SDS-PAGE gel (70V, Stacking gel; 90V Resolving gel, Time: 2-3 hours), transferred to a nitrocellulose membrane and blocked using 5% Non-fat Milk/TBS (1.5 hrs at room temperature). Samples were incubated with MMP13 polyclonal antibody (Product # PA5-95401) using a 0.5 µg/mL dilution, followed by a goat anti-rabb... View More
Product Details
PA5-95401
Product Specifications
Species Reactivity
Human,
Non-human primate
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human MMP13 (109-154aa RTLKWSKMNLTYRIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFT).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Wet ice
RRID
AB_2807204
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: HELA whole cell, human PC-3 whole cell, human U20S whole cell, human A549 whole cell, human HEK293 whole cellRabbit IgG(55KD), Marker 1113, human MDA-MB-453 whole cell, monkey COS-7 whole cell, rat lung tissue, mouse lung tissue.|Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.
Target Information
MMP13 (collagense 3) plays a role in the degradation of extracellular matrix proteins including fibrillar collagen, fibronectin, TNC, and ACAN. MMP13 cleaves tripal helical collagens, including type I, II, and III collagen - but has the highest activity with soluble type II collagen. It can degrade collagen type IV, XIV, and X. MMP13 plays a role in wound healing, tissue remodeling, cartilage degradation, bone development, bone mineralization, and ossification. It is required for normal embryonic bone development and ossificaiton. Mutations affecting the gene can lead to spondyloepimetaphyseal dysplasia Missouri type, metaphyseal anadysplasia 1, and metaphyseal dysplasia Sphar type.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: Collagenase; Collagenase 3; Collagenase3; matrix metallo protease; matrix metalloproteinase 13 (collagenase 3); Matrix metalloproteinase-13; MMP; MMP-13; MMPs; Procollagenase 3
Gene Aliases: CLG3; MANDP1; MMP-13; MMP13
UniProt ID: (Human) P45452
Entrez Gene ID: (Human) 4322
luteolysis
osteoblast differentiation
response to hypoxia
endochondral ossification
growth plate cartilage development
proteolysis
heart development
parturition
response to mechanical stimulus
extracellular matrix disassembly
bone mineralization
collagen catabolic process
embryonic hindlimb morphogenesis
response to drug
peptide catabolic process
response to estrogen
cellular protein metabolic process
estrous cycle
bone morphogenesis
cellular response to fluid shear stress
positive regulation of pancreatic trypsinogen secretion
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support