Invitrogen

MMP8 Polyclonal Antibody

1 Published Figure

View all (19) MMP8 antibodies

Questions & Answers

Questions & Answers

Antibody Testing Data (3)
Published Figures (1)

MMP8 Antibody in Immunohistochemistry (Paraffin) (IHC (P))

MMP8 Antibody in Immunohistochemistry (Paraffin) (IHC (P))

FIGURE: 1 / 4

MMP8 Antibody (PA5-79687) in IHC (P)

Immunohistochemistry analysis of MMP-8 on paraffin-embedded mouse spleen tissue. Sample was incubated with MMP-8 polyclonal antibody (Product# PA5-79687).

MMP8 Antibody in Immunohistochemistry (Paraffin) (IHC (P))

MMP8 Antibody in Immunohistochemistry (Paraffin) (IHC (P))

MMP8 Antibody in Western Blot (WB)

MMP8 Antibody in Western Blot, Immunocytochemistry (WB, ICC/IF)

Product Image Gallery

MMP8 Antibody in Immunohistochemistry (Paraffin) (IHC (P)) — Immunohistochemistry analysis of MMP-8 on paraffin-embedded mouse spleen tissue. Sample was incubated with MMP-8 polyclonal antibody (Product# PA5-79687).

MMP8 Antibody in Immunohistochemistry (Paraffin) (IHC (P)) — Immunohistochemistry analysis of MMP-8 on paraffin-embedded rat spleen tissue. Sample was incubated with MMP-8 polyclonal antibody (Product# PA5-79687).

MMP8 Antibody in Western Blot (WB) — Western blot analysis of MMP-8 in Lane 1: mouse testis tissue lysate, Lane 2: NIH3T3 whole cell lysate, Lane 3: HEPA whole cell lysate, Lane 4: NRK whole cell lysate using 40-50 µg per well. Sample was incubated with MMP-8 (Product # PA5-79687) at a dilution of 0.5 µg/mL.

MMP8 Antibody in Western Blot, Immunocytochemistry (WB, ICC/IF) — Figure 5. Vascular COL18A1 and MMP-8 protein expression levels of HSS compared with USS regions in carotid arteries. Representative immunofluorescence images showing (A) COL18A1 staining and (B) MMP-8 staining; nuclei were stained with DAPI. Scale bar, 200 um. (C) Representative western blots and semi-quantification of (D) COL18A1 and (E) MMP-8 protein expression levels; beta-actin was used as a loading control. Data were obtained from a pool of 16 animals. Data are expressed as the mean +- standard deviation. ***P<0.001. COL18A1, collagen alpha1 (XVIII) chain; HSS, high shear stress; MMP, matrix metalloproteinase; USS, undisturbed shear stress.

Product Details

PA5-79687

Applications

Tested Dilution

Publications

Western Blot (WB)

0.1-0.5 µg/mL

View 1 publication 1 publication

Immunohistochemistry (IHC)

-

View 1 publication 1 publication

Immunohistochemistry (Paraffin) (IHC (P))

0.5-1 µg/mL

-

Immunocytochemistry (ICC/IF)

-

View 1 publication 1 publication

ELISA (ELISA)

0.1-0.5 µg/mL

-

Product Specifications

Species Reactivity

Mouse, Rat

Published species

Mouse

Host/Isotype

Rabbit / IgG

Class

Polyclonal

Type

Antibody

Immunogen

A synthetic peptide corresponding to a sequence at the N-terminus of mouse MMP-8 (120-157aa HTPQLSRAEVKTAIEKAFHVWSVASPLTFTEILQGEAD).

Conjugate

Unconjugated Unconjugated Unconjugated

Form

Lyophilized

Concentration

500 µg/mL

Purification

Antigen affinity chromatography

Storage buffer

PBS with 5mg BSA

Contains

0.05mg sodium azide

Storage conditions

-20°C

Shipping conditions

Ambient (domestic); Wet ice (international)

AB_2746802

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Positive Control - WB: Mouse Testis Tissue, NIH3T3 whole cell, HEPA whole cell, NRK whole cell. IHC: Mouse Spleen tissue, Rat Spleen tissue.

Target Information

The MMP8 gene encodes matrix metalloproteinase-8, also known as collagenase-2, an enzyme belonging to the matrix metalloproteinase (MMP) family, which plays a pivotal role in the breakdown of extracellular matrix (ECM) components. MMP8 is primarily involved in the degradation of type I and III collagen, facilitating tissue remodeling and repair processes. This enzyme is produced by neutrophils and is active in areas of tissue inflammation and injury, where it modulates the ECM to aid in wound healing. MMP8 is implicated in various physiological processes, including embryonic development, angiogenesis, and bone remodeling. However, excessive or unregulated activity of MMP8 can lead to pathological conditions such as arthritis, periodontal disease, and cancer metastasis, where ECM degradation contributes to disease progression. Research into MMP8 aims to understand its regulation and involvement in disease states, providing insights into potential therapeutic strategies for targeting MMP activity in inflammatory and degenerative conditions.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Product References

High fluid shear stress prevents atherosclerotic plaque formation by promoting endothelium denudation and synthetic phenotype of vascular smooth muscle cells.

Molecular medicine reports

Wang J,Wang Y,Sheng L,He T,Nin X,Xue A,Zhang H,Liu Z

PA5-79687 was used in Western Blot to investigate the role of high fluid shear stress in atherosclerotic plaque formation.

Sun Aug 01 00:00:00 UTC 2021

High fluid shear stress prevents atherosclerotic plaque formation by promoting endothelium denudation and synthetic phenotype of vascular smooth muscle cells.

Molecular medicine reports

Wang J,Wang Y,Sheng L,He T,Nin X,Xue A,Zhang H,Liu Z

PA5-79687 was used in Western Blot to investigate the role of high fluid shear stress in atherosclerotic plaque formation.

Sun Aug 01 00:00:00 UTC 2021

High fluid shear stress prevents atherosclerotic plaque formation by promoting endothelium denudation and synthetic phenotype of vascular smooth muscle cells.

Molecular medicine reports

Wang J,Wang Y,Sheng L,He T,Nin X,Xue A,Zhang H,Liu Z

PA5-79687 was used in Western Blot to investigate the role of high fluid shear stress in atherosclerotic plaque formation.

Sun Aug 01 00:00:00 UTC 2021

High fluid shear stress prevents atherosclerotic plaque formation by promoting endothelium denudation and synthetic phenotype of vascular smooth muscle cells.

Molecular medicine reports

Wang J,Wang Y,Sheng L,He T,Nin X,Xue A,Zhang H,Liu Z

PA5-79687 was used in Western Blot to investigate the role of high fluid shear stress in atherosclerotic plaque formation.

Sun Aug 01 00:00:00 UTC 2021

High fluid shear stress prevents atherosclerotic plaque formation by promoting endothelium denudation and synthetic phenotype of vascular smooth muscle cells.

Molecular medicine reports

Wang J,Wang Y,Sheng L,He T,Nin X,Xue A,Zhang H,Liu Z

PA5-79687 was used in Western Blot to investigate the role of high fluid shear stress in atherosclerotic plaque formation.

Sun Aug 01 00:00:00 UTC 2021

Bioinformatics

Protein Aliases: Collagenase; Collagenase 2; collagenase-2; matrix metallo protease; matrix metalloproteinase 8; Matrix metalloproteinase-8; Matrix metalloproteinase8; MMP; MMP 8; MMP-8; MMPs; Neutrophil collagenase; neutrophil collagenease; PMNL CL; PMNLCL

View more View less

Gene Aliases: BB138268; Mmp8

View more View less

UniProt ID: (Rat) O88766, (Mouse) O70138

View more View less

Entrez Gene ID: (Rat) 63849, (Mouse) 17394

View more View less

metalloendopeptidase activity serine-type endopeptidase activity calcium ion binding metallopeptidase activity zinc ion binding peptidase activity hydrolase activity metal ion binding

ossification proteolysis collagen catabolic process endodermal cell differentiation

Performance Guarantee

If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*

We're here to help

Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.

Contact tech support