Search Thermo Fisher Scientific
Disclaimer
Clicking the images or links will redirect you to a website hosted by BenchSci that provides third-party scientific content. Neither the content nor the BenchSci technology and processes for selection have been evaluated by us; we are providing them as-is and without warranty of any kind, including for use or application of the Thermo Fisher Scientific products presented.
Invitrogen
NKG2D (CD314) Polyclonal Antibody
Promotion
View available promotion(s)
Promo code: {{promo.promoCode}} {{promo.promoDescription}}. {{$productOrderCtrl.translations['antibody.pdp.commerceCard.promotion.learnmore']}}
FIGURE: 1 / 1
NKG2D (CD314) Antibody (PA5-79570) in WB
Western blot analysis of NKG2D (CD314) in Lane 1: rat lymph tissue lysate, Lane 2: rat spleen tissue lysate, Lane 3: mouse thymus tissue lysate using 50 µg (reducing conditions) per well. Electrophoresis was performed on 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours and protein was transferred to a nitrocellulose membrane at 150mA for 50-90 minutes. Sample was blocked with 5% Non-fat Milk/TBS for 1.5 hours at room temperature, incubated with NKG2D (CD314) polyclonal antibody (Product # PA5-79570) at a dilutio... View More
Product Details
PA5-79570
Product Specifications
Species Reactivity
Human,
Mouse,
Rat
Host/Isotype
Rabbit
/ IgG
Class
Polyclonal
Type
Antibody
Immunogen
A synthetic peptide corresponding to a sequence of human NKG2D (YQFFDESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYH).
Conjugate
Form
Lyophilized
Concentration
500 µg/mL
Purification
Antigen affinity chromatography
Storage buffer
PBS with 4mg trehalose
Contains
0.05mg sodium azide
Storage conditions
-20°C
Shipping conditions
Ambient (domestic); Wet ice (international)
RRID
AB_2746685
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Positive Control - WB: rat lymph tissue, rat spleen tissue, mouse thymus tissue.
Target Information
Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. NK cells can regulate specific humoral and cell-mediated immunity, and preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. The NK gene encodes a member of the NKG2 family, and the encoded transmembrane protein is characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed in NK cells.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
References (0)
Have you cited this product in a publication?
Let us know so we can reference it here.
Bioinformatics
Protein Aliases: CD314; Killer cell lectin-like receptor subfamily K member 1; killer cell lectin-like receptor subfamily K, member 1; natural killer cell group 2D; natural killer cell receptor; NK cell receptor D; NK lectin-like receptor; NKG2-D type II integral membrane protein; NKG2-D-activating NK receptor; NKLLR; NKR-P2; NKR-P2, ortholog of human NKG2D
Gene Aliases: CD314; D12S2489E; D6H12S2489E; KLR; KLRK1; NKG2-D; NKG2D; Nkrp2
UniProt ID: (Human) P26718, (Rat) O70215, (Mouse) O54709
Entrez Gene ID: (Human) 22914, (Rat) 24934, (Mouse) 27007
stimulatory C-type lectin receptor signaling pathway
positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target
natural killer cell activation
cell differentiation
positive regulation of myeloid dendritic cell activation
positive regulation of interferon-gamma production
positive regulation of apoptotic process
innate immune response
positive regulation of nitric oxide biosynthetic process
positive regulation of natural killer cell mediated cytotoxicity
defense response to Gram-positive bacterium
cellular response to lipopolysaccharide
adaptive immune response
signal transduction
T cell costimulation
negative regulation of GTPase activity
regulation of immune response
negative regulation of natural killer cell chemotaxis
immune system process
Performance Guarantee
If an Invitrogen™ antibody doesn't perform as described on our website or datasheet,we'll replace the product at no cost to you, or provide you with a credit for a future purchase.*
Learn more
We're here to help
Get expert recommendations for common problems or connect directly with an on staff expert for technical assistance related to applications, equipment and general product use.
Contact tech support